Conserved Protein Domain Family
fam_STM4015

?
NF038076: fam_STM4015 
STM4015 family protein
Members of this family are proteins of unknown function, regularly found in a conserved gene neighborhood that also includes two uncharacterized radical SAM proteins. The protein family is named for a founding member from the Salmonella enterica model strain LT2, although the system is rare in the Proteobacteria and relativly common in Streptomyces and related taxa.
Statistics
?
PSSM-Id: 411659
Aligned: 109 rows
Threshold Bit Score: 290.925
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_017585534  61 VAWRLRLSSY-----SEefvpYLARFVEEVDt-TRVRALVIGDWGFEdgsDLSSRDLRDALIGHAEAFPELRSLFVGDVT 134 Nocardiopsis ga...
WP_006676893   2 IEIRLSVGYEeyedgERms-aLIEKLAAGEHs-EQLVSLIIGDWGQAy--ENSPDSFLDTLIANRERFPNLKKLFIGDMD 77  Paenibacillus d...
WP_010491031   2 TEIRLEVGYDeyeegTRme-qLIEQLAAKPEs-REVVELTIGSWGQAy--EDGPDTFMDTLIGHKDAFPALRKLFIGDMD 77  Paenibacillus e...
WP_017692574   2 QEVKLVVSYDeyedgIRme-kLIKDLAAKPEa-SSLESLVIGDWGQAy--ENSPDEFIGTLVESAPSFPSLKKLFIGDMG 77  Paenibacillus s...
WP_007430714   1 MEVKLVVDFDayesgQTma-kLIEELAAKPDs-AEITDLIIGDWGGAy--ENSPEDFIPVLVQHKDQFPKLRKLFIGDME 76  Paenibacillus s...
WP_018884192   1 MEIKLSLDYEayeggAVmv-dLVRELAGKPEs-TEVTSLIIGDWGGAy--EQGPEDFVEELIAQKEQFPQLKKLFIGDMG 76  Paenibacillus m...
WP_017814109   1 MEIKLSLDFDayedgATla-pLIEELAQDDEksQSLTSLLIGDWGAAy--EESPDSFLPVLIESSSRFPNLRKLFIGDMS 77  Paenibacillus
WP_019419312   2 SECKLSVDYEqyedgVKii-dLIEELAGKDEs-LQLESLIIGDWGGSy--ESDSSEIVEAFVRLKDRFPKVRSLFIGDMS 77  Paenibacillus s...
WP_009672566   2 SEVKLSIDYDqyeagKKmk-dLLEELADSPQs-GELTSLIIGDWGGAy--ENDSEETVETLVALKERFPKLTSLFIGDMG 77  unclassified Pa...
WP_010276711   2 SEIKLVIDYEayesgKTmt-eGLEQLAASSQs-QELTRLVIGDWGGSy--ENDSSEIVATLIRLKDQFPKLRELFIGDME 77  Paenibacillus s...
WP_017585534 135 FEENEISWIQQCDLAPLLAAYPRLEELAVRGVGdthsgggtlSLNVP--EHRALRSLTVQSGGLPGRLVREVLSSGLPAL 212 Nocardiopsis ga...
WP_006676893  78 YEDCEVSWIIQTNLSPLLKAFPNLESFTAKGST---------DLRLEplEHARLQELVIICGGLPEEVLADIRNAKLPEL 148 Paenibacillus d...
WP_010491031  78 SEECEISWITQTNLTPLLEAFPQLTSFWIQGST---------GLSLKplKHERLEELVIICGGLSKEVLADIRDAELPEL 148 Paenibacillus e...
WP_017692574  78 YEECEVSWIIQTNLTPLLGAFPELKSFSVMGSS---------GLSLEplEHAKLEELIIICGGLPKDVLSSITHAKLPEL 148 Paenibacillus s...
WP_007430714  77 YDECEVSWINQTNLSPLLEAFPALESFYVKGSQ---------DLSLEplRHSHLQELVIICGGLPASVLQQIYHAELPEL 147 Paenibacillus s...
WP_018884192  77 YEECEVSWINQANLGPLLQAFPQLESFTVKGST---------DLELDplNHDHLQELVIICGGLPKRVLHQIHAASLPEL 147 Paenibacillus m...
WP_017814109  78 NEECEVSWINQSNLGPLLAAYPQLESFIIKGSS---------SLELEplEHARLQELTIICGGLSASVLQSIHKANLPEL 148 Paenibacillus
WP_019419312  78 SEECEVSWINQSNLGPILSAYPELRSLTIKGST---------DLSLDpaHHDKLEELTIICGGLGNDVITNISEGSFKNL 148 Paenibacillus s...
WP_009672566  78 FEECEVSWIMQTNLAPLLEAYPALRSFTIKGST---------GLDLNpaRHENLEELTIICGGLGKDVIHQIYEGSFPRL 148 unclassified Pa...
WP_010276711  78 FDECEVSWIMQSNLGPILDAFPELTSLTIKGST---------GLELDpaRHDKLEELIIICGGLDKQVLSAISEGHFPSL 148 Paenibacillus s...
WP_017585534 213 ERLELWLGVDHYGG-DTTPEDLAPLLSGKALPALRHLGLRNSQRTGAWVRALAEAPVTSRLSSLDLSLGSLRNRDTEHLL 291 Nocardiopsis ga...
WP_006676893 149 RKLELYLGVDEYGFsGSLD-DVLSVAEPGLFPKLTYLGLKDSEIQDEIAQALADAPILDQLETLDLSYGTLSDAGAEALL 227 Paenibacillus d...
WP_010491031 149 RKLELYLGVDNYGFdGGLE-DVKPLMEPGRFPKLTYLGLKDSEIQDEIAIEIANSPILDQLHTLDLSQGTLSDKGAEALL 227 Paenibacillus e...
WP_017692574 149 RKLELYLGVDNYGFdGSLE-DVLPLLEQGLFPKLVYLGLKDSEIQDEIAKAAAKAPILDQLEVLDLSQGTLSDEGAEALL 227 Paenibacillus s...
WP_007430714 148 RKLELYLGVDEYGFdGGLK-DVLPFLDNNPFPKLTYLGLKDSEIQDEIAIAAANAPVIGQLEVLDLSQGTLSDQGAEALL 226 Paenibacillus s...
WP_018884192 148 RKLELYLGVEDYGFdGQME-DILPFLNQNPFPKLTYLGLKDSELQDEIAIAAAQSPVLSQLELLDLSMGTLSDQGAEALL 226 Paenibacillus m...
WP_017814109 149 RKLELYLGVDDYGFdGNLEKDILPFLYENPFPKLTSLGLKDSELQDEIAIAAANAPVVQQLEELDLSEGTLTDKGGEALL 228 Paenibacillus
WP_019419312 149 KKLELYLGVEEYGFdGSLA-DVLQLIEPGKFPLLSYLGLKDSEIQDEIAIAVANAPILDQLHTLDLSMGTLTDKGAEALI 227 Paenibacillus s...
WP_009672566 149 KKLELYLGVDEYGFdGSLE-DVLKLTEPGKFPELTYLGLKNSEIQDELAIALADAPILDQLHTLDMSDGTLSDTGAEALL 227 unclassified Pa...
WP_010276711 149 KKLELYLGVEDYGFnGTLD-DVMKLIEPGRFPQLRYLGLKDSIIQDEIAIAIAEHPILEQLHTLDLSLGVLTDKGGEALL 227 Paenibacillus s...
WP_017585534 292 AAVPaFAHLESLDLHHHYLGEENTERVRAAltgAGVRVDLSDRKGDGgddedtgdeaeddyDYYPAVGE 360 Nocardiopsis ganjiahuensis
WP_006676893 228 ASAR-VKKLKHLDLKYHYMSDEMVKRWKDSglsVDVSDQQ--DTEDD--------------WRYPFLTE 279 Paenibacillus dendritiformis
WP_010491031 228 ASER-VRKLSFLDLNYHYMSDEMVKRWQTSgmsVDVSDQQQSDDEDD--------------WRYPAVTE 281 Paenibacillus elgii
WP_017692574 228 ASDK-IKKLKHLDLSYHYMTNEMISRWNQSgisVDVSDQQQ-SDEDD--------------WRYPSLTE 280 Paenibacillus sp. PAMC 26794
WP_007430714 227 ASES-IKGLKHLDLSYHYMSSEMVERWKNSglsVNVDDQQEADEEDD--------------WRYPSLTE 280 Paenibacillus sp. Aloe-11
WP_018884192 227 ASES-VRKLKHLNLSYHYMSDEMLLKWKQSglsVDVSEQQESDE-DD--------------WRYPALTE 279 Paenibacillus massiliensis
WP_017814109 229 NSEA-VRSLKHLNLNYHYMSDSLVLKWRNSgvnVTLDDQQDLDD--D--------------WRYPSLTE 280 Paenibacillus
WP_019419312 228 HSEK-IMKLKLLDLSYHYMSDEMMNQWKQSglnVDISDQQDADEDED--------------YRYPSLTE 281 Paenibacillus sp. OSY-SE
WP_009672566 228 NSER-VKKLKYLDLSHHYMSDEMVSRWKSSglnVNTDDQQDMDEDDD--------------YRYPSLTE 281 unclassified Paenibacillus
WP_010276711 228 QSEK-IRKLEFLDLKYHYMSDKMVNRWKKSglnVDVSEQQEEEEEE---------------YRYPFLTE 280 Paenibacillus senegalensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap