Conserved Protein Domain Family
IcmL_DotI_only

?
NF038072: IcmL_DotI_only 
type IVB secretion system apparatus protein IcmL/DotI
Statistics
?
PSSM-Id: 411655
Aligned: 6 rows
Threshold Bit Score: 289.375
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_019998609      8 NAESVLMRASTYKAAYKIMAIYAAVATAVACVGVGSAVYLALTRPEPRYFATTTNGQIQPLTPLDRPHMSSADVLNFAAR 87  Aureimonas u...
2_ncbifamImport   1 AEQLALQKNNLYRDNYRRVMAFLLASVVITVSLLAVLSYQIITTPKPAYYATTTTGRVIPLQSLDMPVVTNTYLLQWAAL 80 
1_ncbifamImport   1 GLKLVILRNAFYRDNYRRAIIVLLFALIINCGLAFMIFYKWMYPPQPEYFATTADGRIIMLHPLSDPVLPDDFVLQWSTD 80 
WP_018577057      5 ALTVVALRNQFYKDSQRKVILALLVAIIVNIVLASMLVYILTHPPAPKYFATSINGRITPLFPLDEPNQSDSAVLQWANQ 84  Legionella s...
WP_017378255      5 ALTQVKLRNDFYRDNFRRVSLILLISILINVALLAAFIVSLSSRPEPKYFATTSNGQLIKLHSLSFPVMNDSAVISWLSD 84  Piscirickett...
WP_018067324      8 ALETVMKRTQTYRTAFRVMSVISCALLVTTVVSVGAAAYLATHRPEPRYFATTTNGQILPLVALDKPHLNANEVANFATQ 87  Martelella m...
WP_019998609     88 AVTNSLTYSFDNYRAQFQEAQQYFSqPDGWNSFVEAVQKSKALDLVRNGRFNSSAIAQTPVIVRQGPNASGSYEWIVQMP 167 Aureimonas u...
2_ncbifamImport  81 ATRAVYNLDFENYTKQLDNASSYFT-PTGWESLTNAMKSSGAIDSLKNNKLFMAGIVNGPAVILDQEVVHGRYSWRVQLP 159
1_ncbifamImport  81 AVRKAFSLDYEHWREQLQEASNNFT-PDGWKWFLNSLKSTNNLKTLVDLKMVSNATVTGAPTVVRKEVVGGHFAWNIKMP 159
WP_018577057     85 AAIAAFTYNFVNYRDELQASSGFFT-ADGWDQFLNALQQSNNLDAVKAKKLIVSAVATRAPIILQKGVLNGNYSWRVQMP 163 Legionella s...
WP_017378255     85 IVPNINSLDFLNYRTQIREKRKYFT-SYGWEQYLKAFQP--IVEKIRDNKYVARAVVSDVPVVIQKGNIDGVYSWRLQVP 161 Piscirickett...
WP_018067324     88 AVTAALTYSFTNYRTDLTAVQKYFTqPAGWNSFIDALDKSGQLEMVKERRLNTTAVAQDAVILSQGPNARGVYQWVVQIP 167 Martelella m...
WP_019998609    168 IRITYQSASEVTGQSNMVTVRLTRLPTYETPYGIAISQFNA 208 Aureimonas ureilytica
2_ncbifamImport 160 LLVTYTSASIQQKAHFIITMDIIRVPVIDAAKSIQINRFSA 200
1_ncbifamImport 160 LLVTYTSEGHTINMPMEVTLIVVRMPTQDYPQRIAINNFLA 200
WP_018577057    164 ILVTYQSASEFTQQNNVVTMLITRVSTLNSPRGIGISQFVV 204 Legionella shakespearei
WP_017378255    162 MIITYQQGASRDTQNVIWTVLIQR-SNEHADSLFGIAQIIQ 201 Piscirickettsia salmonis
WP_018067324    168 LRITYESASEVSGQDLLVTVTINRMETYQTPEAVAINRFIA 208 Martelella mediterranea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap