Conserved Protein Domain Family
Pr6Pr

?
NF038065: Pr6Pr 
Pr6Pr family membrane protein
This family is defined by TCDB as prokaryotic 6 TMS (Pr6Pr) family membrane protein(http://www.tcdb.org/search/result.php?tc=9.b.302). The function of this family proteins is not understood.
Statistics
?
PSSM-Id: 411649
Aligned: 4 rows
Threshold Bit Score: 179.603
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_092854710  42 FLSYFTIQANILFAVVLLSAEIAPSLAFGRWASRSSTKTALLIYVGVAGGIYAWLLKDVwHPSGWQLRGDQ---ILHYCI 118 Rhizobium miluo...
WP_015490561  38 WFSYFTTQSGMAGVVVLAASGLHALRGRVELPLMAAVRAVVLSYVVVSGVVFGLIVLES-SSQAYYVEVPWssrLLHFVI 116 Clavibacter mic...
WP_069909221  49 FWTFFTHLTNLW--LLLTYAAVLSGWRWLGWFRRPVIMASAAAFITLVMLYYHFMLAPTlNMQGALAVATW---LLHYVA 123 Devosia insulae
WP_114817873  40 FFSYFTILSNVLVALALTAPVVAPNTRLGRWFAGEAVRAAMAMYIVVVGVVYHFLLAPTwNPQGLALLGNS---LLHYVM 116 Brevundimonas b...
WP_092854710 119 PLLAAFDWIFLVERNRLDWRNAIWWLLFPALYSVYSLVHGQLSRFYPYPFLDVRDIGLQAVLINMAFLGVLFLA-LGGVL 197 Rhizobium miluo...
WP_015490561 117 PAYALLDWTLAPGRPRVTWKAVGWAMLFPVAWCAFTEVRGPRVGWYPYFFLDPAQVGVPFEIAAWLALVAGVLAgVSASV 196 Clavibacter mic...
WP_069909221 124 PILYLVWWALFAPHGVLRFRHIGLMLLPGIGYVAWVLLRGAVVQEYPYDILDAGKFGYGGVAIGVAVLLVAVSI-FSVII 202 Devosia insulae
WP_114817873 117 PAAFVLDWLLFAPKGRLNWKDPAKWLIFPLIYGGWTLIHGALSGWWPYPFVDVGALGLGRVLLNFVGLLIFFLI-VGLII 195 Brevundimonas b...
WP_092854710 198 ILLDRV 203 Rhizobium miluonense
WP_015490561 197 VALSRV 202 Clavibacter michiganensis
WP_069909221 203 VWGDRV 208 Devosia insulae
WP_114817873 196 VTLDRT 201 Brevundimonas bullata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap