Conserved Protein Domain Family
MamC

?
NF038051: MamC 
magnetosome protein MamC
Magnetosomes are membrane-enclosed organelles containing crystals of magnetite (Fe3O4) that cause magnetotactic bacteria to orient in magnetic fields. MamC interacts with the magnetite surface and affect the size and shape of the growing crystal.
Statistics
?
PSSM-Id: 411643
Aligned: 8 rows
Threshold Bit Score: 95.5904
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011383388  26 LAPYLAKSVPGVGVLGALVGGAAALAKNVRLLKEKRITNTEAAIDTGKETVGAGLATALSAVAATAVGGGLVVSLGTALV 105 Magnetospirillum
WP_112147258   5 LAPYLAASVPGVGVLGAIIGGAAAAAKNLELLKTGRISQREAGIDTAKETVGAGVATAFSAAAVGFVGAGLFTSIGVAVI 84  Magnetospirillu...
WP_085440065   6 LAQFLTTSASGTGVLGAVVGGSAAIAKNIHLYNKGLVSPEEAAIDSGKEAAGAGVATAVSAVAAGAVGGGLVVSLGTALV 85  Magnetofaba aus...
WP_069186831   5 LAPFLAQSVPGVGALGAIVGGSGALAQNLKKHKDGEMETNEVVVETAKEAAGAGVATAVSAFTVGLVGGGLVVSVGTAFA 84  Candidatus Tera...
WP_046021222   5 LAPFLAQSAPGVGVIGSIVGGSAALAQGLRAKSRGEATNKDVALHTVKEASGAGVATAISAYTVGVVGGGLTISLGTAFV 84  Magnetospira sp...
WP_153294519   8 LAAYLTQSTSGIGVFGAIVGGAAAAAKNYKDNQDGLVSTKDAVINTSKETAGAGLATVVSAVAAGAVGSSLALSLGTAVV 87  gamma proteobac...
WP_149685989   3 LATYLASSTSGIGVFGALVGGAGAAAKNIKDSRDGLVTPVEAVVDTSKEAAGAGVATVVSAVSVGAAGVGLGASLGIAAV 82  Ectothiorhodosp...
WP_158658879   5 LGPYLAETAVGMGVMGAIISGTNAAAKNIERVRTGSASEKGALIDVGNEVVKNGVATAATFAVVASLGVEIVAAVGVTLI 84  Methylocystis b...
WP_011383388 106 AGVAAKYAWDRGVDLVE 122 Magnetospirillum
WP_112147258  85 AGIAGKYAWDRCIDFGE 101 Magnetospirillum kuznetsovii
WP_085440065  86 AAVAGKYAWDRGAEYLE 102 Magnetofaba australis
WP_069186831  85 AAVAGKYVWDRGMDYIE 101 Candidatus Terasakiella magnetica
WP_046021222  85 AAVAGKYAWDRGMDYLE 101 Magnetospira sp. QH-2
WP_153294519  88 VAAGAKYAWDRGMEAVD 104 gamma proteobacterium SS-5
WP_149685989  83 TAIGAKYLWDRSMEQIE 99  Ectothiorhodospiraceae bacterium BW-2
WP_158658879  85 VGTTLKYAWDRGRDAVE 101 Methylocystis bryophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap