Conserved Protein Domain Family
not_Tcp10

?
NF038047: not_Tcp10 
AAWKG family protein
Members of this family are found primarily in Streptomyces. The family is notable in part because a region outside of the N-terminal region modeled here contains 9-residue repeats that resemble the 18-residue repeats found by PF07202 in the C-terminal region of eukaryotic T-complex protein 10. The family is uncharacterized. This model was constructed, and named for family's most prominent motif, AAWKG, to head off any possible confusion with Tcp10.
Statistics
?
PSSM-Id: 468326
Aligned: 12 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_121887283    7 HWARAVESFTGYKMPSRHGMFDdvkglePNGNAPLISVAi--------eDREFMEMTDSAyQLYSGPNVDGHDFVIHFFL 78   Streptomyces ...
WP_123997052    5 NWEHIINLMTGFTLGERDKIMG------VTGDSGIPWLA----------VQIKAKGNKDG-PADQWPHNDGMGAFIQFHA 67   Streptomyces ...
WP_089101320    5 NWEHIINLMTGFTLGERDEIMG------VKGDGGIPWLA----------VDIKKKPRDDRkPVDQWFHNDGMGAFIQFYS 68   Streptomyces ...
WP_054228411    5 NWEHILALLTGWTLPDRSAVTs------TKGDSGIPWVN------------VKIKKKSLDePTNVLRDD---GATFQFYT 63   Actinobacteri...
WP_093715744    5 NWENIISTLTGWDMPSRADFTTse---sAKGSTGIPWIEt---------LNIWQETKHVTlSPSIIEDPDRMGWYFEFYE 72   Actinacidiphi...
WP_020487534   19 YYAQAITNFTGYTIPARSSLFNs-----LSSDSGDDFSDlklfrmeisgQTMRAVSTEDYtALSGFQKSKGEDYDLAFYD 93   unclassified ...
WP_135340333    9 NWENVVSQLTGFAGGTREDVGKvgsmadSGGGLGSGWLKad------ikRKGLYWLTDNEqTTDDKYKP---ERTIVFYD 79   Streptomyces ...
WP_100249024    5 LWEEVVGQITGFNGGTREAVGKvggtsdANGNLGGGWIKad------iqKIDMRLLAEEKqTAAPDYNP---ERVVRFYD 75   Streptomyces
WP_056565271   11 WAEYLAAQLTGFAGPTREEVGKigatgdQAG-EGAGWLRas------vkKK-------GGhEAADNVTPGPLERIIRFYD 76   unclassified ...
WP_112446627   11 RWEYVVGQLTGFAGGKREDVGKvgstgdQTV-PGTGWLRah------pkALPLLNDSEGNtESLPNVETKGPERVIKFYD 83   unclassified ...
WP_128984511   15 VWEDIIKQFTGFDGGTRAQVAAvggadtKQG-DGSEWMRik------ieKGTTSRATTTWiP-YGGFDG----RVIKLYA 82   Streptomyces ...
WP_150486956    6 SWESVVKQLTGFDGGTRAHVAAvggadaAAG-DGSEWMTvr------igHSDGYRETTPDlDSPGGTLG----RTMKFYG 74   Streptomyces ...
WP_121887283   79 PGkenpdsvdvskysesELKEKIYPRLRKVVIDFVGpngsDVKLNYLSPFSWSEYDSDSSLVGMNHPmgqfvqgagsaly 158  Streptomyces ...
WP_123997052   68 GH---------------GTDVQKYEANVTFTDQTAG----RQYWQRSNDALKLLVQPPYKTLGMSSG------------- 115  Streptomyces ...
WP_089101320   69 GT---------------GQNVQKYEANVTFTDQTAG----RQYWQRSSDALRTLVQPPYKSLGVSSA------------- 116  Streptomyces ...
WP_054228411   64 GS---------------GNNISMYQADVSYADISLG----KQFWTRTGNALEHMLY-DFSSLNVSDP------------- 110  Actinobacteri...
WP_093715744   73 RFd--------------GDKVKIWKVQIRYSDKFHGg---KQFWERSLAVLQHLTMNQFKSYDFDTP------------- 122  Actinacidiphi...
WP_020487534   94 AGgd-----------gaHNSVSLKKARIVMIGVGVGddgrADLWGDGAISGGGEFEGSYSHVQWDSGpmaqyisgsklal 162  unclassified ...
WP_135340333   80 DAgsng-------yvdyFYEVTLTTTWSSSGGSDFSdggkAGAYDWGYGEALEQLVNQHTVAHFNGDrr----------- 141  Streptomyces ...
WP_100249024   76 YAgpds-------aivkYCEVRLSVPWSSSTGNDFSdggvAGKFDWLYGKALEHLKGTGSIGGF---------------- 132  Streptomyces
WP_056565271   77 FNkevt-------evtgYFEVTLTVPWNE-GGNDFSdngkAGAYDGGYRDALYALVTKHTTVGYTHQf------------ 136  unclassified ...
WP_112446627   84 IAhktn-------gvekYWEITLGVPWNE-GGNDFSnkgkAGAYDWGYGEALKSFMDNGTTANLDLGy------------ 143  unclassified ...
WP_128984511   83 Ggkls--------knvlVYTITLTVPWSGPDGSHWHnhgvASAFDWGYREAIDRLLTTYTTAGFGGKy------------ 142  Streptomyces ...
WP_150486956   75 APgtgs-------qnvqVYTVELGLPWSSSNGADWSdtgnAGAFDWGYGEALTKLRTEYRTAGFGGQy------------ 135  Streptomyces ...
WP_121887283  159 qlgyrgitthnnidfssNGVTVDASRAMDFESFTRTAQAYDRVAKFFMDHAETLKQWKESLGKDTAAWKGKAAEVFADLI 238  Streptomyces ...
WP_123997052  116 -----------------SGGSPTLDTGVDLTTFTTVAQSFDRAGDFFTKHSETLKQWTESLGDENAAWKGKAAGVFYDLI 178  Streptomyces ...
WP_089101320  117 -----------------WGGSPSLDNGVDLASFTTLAKSFDNAGTFFTAHAETLKQWTESLGDENAAWKGKAAGVFYDLV 179  Streptomyces ...
WP_054228411  111 -----------------YGGAPSTANGVDLHDFSRIAAAFDVAGDFFQQRTEILKQWLESLGKEQAAWKGTAAGVFYDLI 173  Actinobacteri...
WP_093715744  123 -----------------LGGQPTETTGLDLATFVKAARSFDAAGDFFSAHTQILQNWLDQLGEDQAAWKGTGAEGFRKLI 185  Actinacidiphi...
WP_020487534  163 d---ellnnhttkgwsfSNLSVLDGNAVEFKSFEETGQSFDRAMQFFKDHSDVVNGWMKSLGEDQAAWKGKAASLFWHLL 239  unclassified ...
WP_135340333  142 ---------------ypHNEAVDPKSSVDLNTFIATAKSFDEVRQFFADYQKPLEGWDRDLGGDDAAWQGSAADTFHALI 206  Streptomyces ...
WP_100249024  133 -------------------ESLTAKDSADLRTFVTTAKSFDEVQEFFGTYAPHLEKWVTDLGGDDAAWKGNGADAFRELI 193  Streptomyces
WP_056565271  137 ----------------pTVPKILESDEVDLTSLVTTAKAFDEVQKFFTDYGAELEKWVKDLGGEDAAWQGSAADVFRMLL 200  unclassified ...
WP_112446627  144 ----------------vGVKAVDEKDCVQLATIMDTAKSFDEVRTFFIDYQKKIETWSKSLGGDDAAWKGSAADVFRTLI 207  unclassified ...
WP_128984511  143 ----------------ePSRVVAFADAPDLTTLPPIAMAFDRVSRFFREHSPKLERWVKDLGGEDAAYRGSGADVFRDLI 206  Streptomyces ...
WP_150486956  136 ----------------pHTKAVADEDSVDLRTFPATAKAFDRVTAYFRERSPVLEQWVKDLDGEYSAYRGSGADVFRDLI 199  Streptomyces ...
WP_121887283  239 GGLHKNYSGFADQMHPAKFSTDHESMWD-YYASSSLQGDAILGAGNAVFAAIRDLYQAWTDWETGTNVDWVALSQGADPV 317  Streptomyces ...
WP_123997052  179 NNLHDKYETFRTELTPPGFSPSHVSVDT-GYPSKTLHGDSLITAQVALHTALSHMYDQFLKFMYRNAQPILVTRPDGQQT 257  Streptomyces ...
WP_089101320  180 NNLHDKYETFKSELTPPGFSPTSISVAT-GYHSSTLHGDSLIGAEVALHTALSNMYDEFMRFISKNASPILVTKPDGTQT 258  Streptomyces ...
WP_054228411  174 DDLRAKYEHFTSELRPPGFASANHSVANpGYQPTTLHADDLISAERYLYKAYEKLYETYRNFYWRNGQAVSFAQADGSTG 253  Actinobacteri...
WP_093715744  186 DHLHGKYAHYSSQLRPPGFEPQHTSRVLpGYTPSTMHSDSLIGAEAELYDVLTKLYGFAFDFYNEKADLVPITKTDGQQH 265  Actinacidiphi...
WP_020487534  240 KELKTNYDGYVSQLGGRDYSPKNTTVGG--YVPKSKLSDALAAAQTALKDAVTDLQTAWNNWAKDG-------------- 303  unclassified ...
WP_135340333  207 NGLHHGYKDYADLLTPTGTTVAAEFGT---YTSTSVVGDNIIRGGNAIHNAAKALHTAWTTWTGKYG------------- 270  Streptomyces ...
WP_100249024  194 AGLHLGYKEFADLLAPTGNPTAATFPSSdGYTPKSVVGDNIMRGGEAIHAATVSLHNAWSTWTGKPG------------- 260  Streptomyces
WP_056565271  201 DGLAYGYKDLKKDLTPTGTTVSLAFGd--TYNPTSSIGMEIARCAQAIHDAANALMEAWNTWLQAKVTIDAATPGEKLTY 278  unclassified ...
WP_112446627  208 QGLDLGYKDLGEELTANRGIASVKLGNLpAVASDTSTGREILRCAKAIHDAATKLHETWETWSFSSETQPAT-------- 279  unclassified ...
WP_128984511  207 SGTSTGYKDFLNLIALPAPRSGRSSRIDpDFRADSLVADRIMEAEDAFLSTAQRLKEIHEGWIATNQ------------- 273  Streptomyces ...
WP_150486956  200 DALSVGYKDFLQELSSTGSGS-TVSVSEpSYTSDSVVSDRILQAELTIFGAATTLGRAWDAWVAGNM------------- 265  Streptomyces ...
WP_121887283  318 EflpgLGSPYGILFSMLESVQTWAYNHNArfavegtksgstmtyysgnYTGAGTWRETKTTTHFyvlrsEAEQVIPGLGN 397  Streptomyces ...
WP_123997052  258 Tqi-iDGDTRAVLVSMMNEIAEWIHAHNTd------------------LTIERHKTKADKLTTG-----PNFSDTTVWGN 313  Streptomyces ...
WP_089101320  259 Sdl-iDGDSRNVLNLLLLEVMQWVATHNVpkv-------------hgeLVIVG-DSVSEDWSTD-----PDYSDTTVWGN 318  Streptomyces ...
WP_054228411  254 Sgr-lAADPRDILNEMMADIAQWITVHNWsnv-------------rygMYQDVSGNPEFHRSHEewtavDGFSSAVTWGN 319  Actinobacteri...
WP_093715744  266 Mvn-vPADPQKILNNLMLDVGEFIRANNW-------------------LAKDKLR--------------IGLNTHVAWGS 311  Actinacidiphi...
WP_020487534  304 -----QHDPHRHLVKVLDDVSGFVLKDNIqh---------------vnVKTQYYGGYGGGGSYKtysttAEFKQTSEYGD 363  unclassified ...
WP_135340333  271 ------WLPTHHLDNWIDKVAIYLNARNLsk--------------------irQSTAARSRYVKfgdfsIYYDEGSGIGD 324  Streptomyces ...
WP_100249024  261 ------WLPTHHLDDWIDKVIAYLNVRNIan--------------------trVEKLSR---LPnanfsIYYDEGSGIGD 311  Streptomyces
WP_056565271  279 N----TYLPTYHLNAEVNKVALYLNENNLdr--------------------vfMITGSK-KLYIgggftIYHPL---YGD 330  unclassified ...
WP_112446627  280 ------FTPTHFLDLEIDKVVKYINSENIqk--------------------vtLDAPNN-KLVQgegfsIYYEP---FGD 329  unclassified ...
WP_128984511  274 ------WLGTALLDKHIDIAATWLNENNIak--------------------mrQTAAGV--SQAgegfsTQHPL---YGD 322  Streptomyces ...
WP_150486956  266 ------WLGTAHLDRLLDELAVWLNENNIrr--------------------mqQSGPGV--SQAgagflVVHPV---YGD 314  Streptomyces ...
WP_121887283  398 LNDVSTWAGLGTKAVESWNKGVEEHLAPAADKALSSVNNAFIKARRVIDEVLSPEVTNY 456  Streptomyces shenzhenensis
WP_123997052  314 LKDTSTWAAIANEALYRWRTNIETNLDVPARAEVATLQQTWSRVLNPGWNKAFAFEDKN 372  Streptomyces sp. Ag82_G5-5
WP_089101320  319 LKDSSTWSAIANEAQYRWRTNIETNLDAPARTQVATLQQSWSRVLNPGWNTAFSFEDKN 377  Streptomyces hyaluromycini
WP_054228411  320 LQDTSTWSAVANEAVNRWTRNVQTNLDTPAVPVVNELQRDWSRVLNPGWNPRFAFSDMS 378  Actinobacteria bacterium OK006
WP_093715744  312 LTDASTWSAMANEAVRRWTANVEHNLDVKAKPLMVELRTTFQHTLDPKWNPDFAFDDSD 370  Actinacidiphila alni
WP_020487534  364 LTQHTTWKKIADAAVKSWSDHADTMLKQPAIDALSNVKSAWADVTD-AFDQEVTDKNSE 421  unclassified Streptomyces
WP_135340333  325 LRTAEAWQRLSQKAYTDWVANLAG-LDTAANTAAVTLNNALADVGEANSSFVFNAGMQD 382  Streptomyces palmae
WP_100249024  312 LRTQEAWTRLGNRAYESWRAGLETDLDPTAANAARTLNNALADIGESPSTFTFNLGFTD 370  Streptomyces
WP_056565271  331 LTQKPAWEKVAQEAYKHWVETIVATLDTASNTQTQKLNEVFNNLANATGNLSFSTGFSD 389  unclassified Streptomyces
WP_112446627  330 LTQKEAWQKLAQQAYLGWVANLLS-LDTVALAQASALNNAFADLKYATSSFTFNPGFTD 387  unclassified Streptomyces
WP_128984511  323 LSDASGWKGVSREACAEWLAAIGTHLDVPARTAVIEFNSKMRGFQR-RAPFVFTAGITS 380  Streptomyces roseicoloratus
WP_150486956  315 LTKEASWKALSRAACAAWTANLAS-LDTAAQQAMLDLNQAMIAPGS-ASDFTFRPGAGS 371  Streptomyces nitrosporeus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap