Conserved Protein Domain Family
act_def_assoc_A

?
NF038043: act_def_assoc_A 
actinodefensin-associated protein A
Actinodefensin (see family NF038042) is a bacterial branch of the arthropod defensin family. Members of that family occur in the Actinomyes lineage, have a distinctive N-terminal region that may reflect how processing and transport occur, and are found in a conserved gene neighborhood. Actinodefensin-associated protein A is found exclusively in these conserved gene neighborhoods.
Statistics
?
PSSM-Id: 411636
Aligned: 7 rows
Threshold Bit Score: 614.114
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_119836389   3 TQTDPPWNATPALLRYKEGTWQQVDEKTLADEHASANLMFVLARIAGLRPPFGRSVFTDVLQRTPGTVLSGEEITPQAQE 82  Actinomyces sp....
WP_141425149   2 SHHDTPWAGSNQLLINRAGTWEQVDEDALADKHTSASLRFVLARIADVRPPFGQSLFTEVLHRAPGTRLANDSIQTLQPE 81  Actinomyces joh...
WP_076132266   2 SLHDTPWSENSQLLINNEGIWEQVNEEVLANSHASASFRFILARIADIRPPFGQSVFTNVLHRAPGTQFIGGSIQVLHPE 81  Actinomyces nae...
WP_147524442   2 GHYNSPWNTTNQLLINHAGTWEQVDEDTLAKKKTSASLRFILARIADVRPAFGQSIFTDVLHQSPGTQLVNNSIQTMQAE 81  Actinomycetacea...
WP_073451526   2 DLKHTPWASACTLLSKSTGSWQPTTEKSLAEQHTAVSLRFLLARIADVRPPLGQSVFIGALQLTPGTALVGDNVQPMAQD 81  Actinomyces
WP_086615403   6 TSSASPWAEAAELLRNDAGSWDSVTEEALAADHASASLMFVIAGIAGVRPSFGQSLFTGVLRRTPGTRLEGDAITPYEQS 85  Actinomyces rum...
WP_076067806   6 SAASSPWMGCADLLYFGEDSWVSVSRADLASAHVSASIMFVLARIATVRPPFGRSLFEGVLSRTPGTRRDGNAITVYEHS 85  Actinomyces nae...
WP_119836389  83 GD-DPGTRSLESAERLLAASLARYGAR--GAVQSALPVDHMITRYLSDITSrqPETSPQGEQRRSATAVVDARGVRDLIG 159 Actinomyces sp....
WP_141425149  82 QY-STGVISLETAEEVLTQALRRNASAtgPFSSASSPVDDIILRYLNALTA--PTADGASAPSETGASDIDARGIRDLVG 158 Actinomyces joh...
WP_076132266  82 QY-NIGAIGLEAAEESLAQALRRNITTigPFSSTSASVDDIILGYLNALAA--PSLDNVSTAPETRASDIDARGIRDLVG 158 Actinomyces nae...
WP_147524442  82 QY-SIGTTCIDTAEEALAQALRQNTSTvgSSSSASTPVDEIILHYLNSLTA--PTFDETSKLSEAEMTEIDARGIRDLIG 158 Actinomycetacea...
WP_073451526  82 LYdSVGASSLRQGEEVLGAALARHSDS--DTIDSLTPVDTAIPHYLTSLM---RRHQPETSPKTGPATAIDARGIRDVIG 156 Actinomyces
WP_086615403  86 QY-DLEPRFIGEAERVLAKALHQHGVN--GDIRSSHVVDDLVTRYVSELVTs-AATSSSEPPVQVEAQDIDLRGIRDLIG 161 Actinomyces rum...
WP_076067806  86 QY-DLEPYSLDSAESVLAEALRGHGAS--DALASADAVDELVVRYLSELVS--DDDVSVAPSMVKGPAEVDMRGMREVVG 160 Actinomyces nae...
WP_119836389 160 AVEGEtrEEAGSAYPAFLQRLLR---RDKSRSSQpgpvladapeaspgSLDSADSTGTaPEAAEPelslDPQWLAGEAIQ 236 Actinomyces sp....
WP_141425149 159 SIPSE--AKKDTQGGGFFQRLLS---KKDKSDSH--------------EHEHASEASE-PIIVEP----EPQWLSIDAIQ 214 Actinomyces joh...
WP_076132266 159 SIPSE--AKKDTQGRRFFQRLLS---KKNKSDSH--------------EHEHALEGSE-PIIVEP----APQWLSIDAIQ 214 Actinomyces nae...
WP_147524442 159 SIPSE--AKKYPRSEGLLQRLLP---GKDKSDSQ--------------EKEHMSDGSE-LIIEEP----EPQWLSIDAIR 214 Actinomycetacea...
WP_073451526 157 AISSE--QSAPAATRGLLRRILG---KADDAHGH--------------DHGAGNEAEEgLTVVEM----EPQWLSIDALQ 213 Actinomyces
WP_086615403 162 AVEAE--QERQQSRGGFLDRLLRsgrRNSKPDQE----------------EHQSTSEDvVSEIEV----APQWLTVDAIN 219 Actinomyces rum...
WP_076067806 161 AVQGE--RKMQQKKCGFLDRLMG---RDRRQLQT--------------NQKPESGDTTpSIEV------APQWLSVEAIK 215 Actinomyces nae...
WP_119836389 237 MIDVARMVSLTSWQEAVKDLPPRTSQLLWTAAEDPA---TSALAPYRPAHDPQVLAAFAQVPATQRAITLPNGLRTLDAA 313 Actinomyces sp....
WP_141425149 215 MIDVARIVSLSSWEEALRGLPPRVAQLLWTTSSDSS---PSSDTPYRPAHDPVVIGAFAQVPFEQRSMEVRNGIRTHDAA 291 Actinomyces joh...
WP_076132266 215 MIDVARIVSLTSWEEALRGLPPRVAQLLWTASGDSS---LSSDSPYRPAHDPVVIDAFARVPFEQRSTEVRNGIRTYDAA 291 Actinomyces nae...
WP_147524442 215 AIDIAKIVSLASWEEALRGLSPRVSRLLWTTSNDTS---PSSQLPYRPAHDPAVISAFAQVPFEQRSMEVRNGIRTHDAA 291 Actinomycetacea...
WP_073451526 214 TIDVARIISLSSWEDALSGLSPRVSQLLWTASNDPAgspGSSRAPYRPAHDPEVLTAFARVPYAQRSEEIRNGIRTLDAA 293 Actinomyces
WP_086615403 220 MIDVARIVSLASWQEAIKGLPPRVCQLLWTAAGKPA---TSGASTYRPAHDPRVIAAFAAVPYKERSASVRPGVRTHDAV 296 Actinomyces rum...
WP_076067806 216 MIDVARIVSLTSWQEALVGLPPRVCQLLWTAADDPA---VPLDAVYRPAHDPQVLAAFAAVPYEERATEIRPGVRTDHFA 292 Actinomyces nae...
WP_119836389 314 LCQRYGRDPVDDHAAARLQAVREAPRVWQRWEEELAQGSLAARGLIDADGMRRIGQDPFLRQKYALSVKKTVETERWVTS 393 Actinomyces sp....
WP_141425149 292 LFRRFGKEPVNDHAAARLRAVKEAAEMWTSWQEELADGSLAAQGCIDVDGMTLIGKDPFLRQKYAPDVKKTVETERWVTS 371 Actinomyces joh...
WP_076132266 292 LLRRFEREPVSDHAVARLCAVKEAAEMWPLWQEELADGSLAAQGCIDVEGMTLIGKDPFLRQKYALDVKNTLETERWVTS 371 Actinomyces nae...
WP_147524442 292 LFRRFGKEPVNDHAAARLRAVKEAAEMWPSWQEHLADGSLAAQGCIDVDGMTLIGNDPFLRQKYALDVKKTVETERWVTS 371 Actinomycetacea...
WP_073451526 294 LFRAQGRDPVNDHAAARLRAVSEAVSMWPSWQEELRDGTLAANSCIDPDGLAIIGQDPFLRQKYAHDVKKTVEIERWVTS 373 Actinomyces
WP_086615403 297 ICRRYGRDPIDDGAAARLEAVREAASAWGTWQEELADGALAARGLIDTEGLAQIGQDPFLRQQYAPDVKNTVETERWLTS 376 Actinomyces rum...
WP_076067806 293 VCRRYGRDPVDDHAAARLRAVREAEDAWGAWREELADGVLATRGLIDVDGLTRIGRDPFLRQQYALDVKNTVATERWVAS 372 Actinomyces nae...
WP_119836389 394 WLEAGGSLTE 403 Actinomyces sp. 2119
WP_141425149 372 WLSAGGSLTE 381 Actinomyces johnsonii
WP_076132266 372 WLSAGGSLTV 381 Actinomyces naeslundii
WP_147524442 372 WLSAGGSLTD 381 Actinomycetaceae bacterium
WP_073451526 374 WINNGGSLTE 383 Actinomyces
WP_086615403 377 WLDAGGSLKE 386 Actinomyces ruminis
WP_076067806 373 WLDAGGLLKE 382 Actinomyces naeslundii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap