Conserved Protein Domain Family
PavB_Nterm

?
NF038031: PavB_Nterm 
PavB family adhesin N-terminal domain
This HMM describes the portion of PavB from Streptococcus pneumoniae, and closely related proteins from Streptococcus mitis and Streptococcus pseudopneumoniae, N-terminal to the repetitive region with variable numbers of SSURE (Streptococcal Surface REpeats) regions (see PF11966), which bind fibronectin. The PavB region is notable, in part, for its rare variant, WSIRR, of the YSIRK motif signal peptide. Full-length versions of proteins from this family have a C-terminal LPXTG-containing region for sortase-mediated anchoring to the cell wall.
Statistics
?
PSSM-Id: 411624
Aligned: 7 rows
Threshold Bit Score: 233.151
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000671388       1 MKFNPNQRYTRWSIRRLSVGVASVVVASGFFVLVGQPSSVRADGLNPTPGQVLPEETSGTKEGDLSEKPGDTVLTQAKPE 80   Streptococ...
1_ncbifamImport    1 MKFNPNQRYTRWSIRRLSVGVASVVVASGFFVLVGQPSSVRADVVNPTPGQVLPEETSGTKEGDLSEKPGDTVLTQAKPE 80  
WP_000671366       1 MKFNPNQRYTRWSIRRLSVGVASVVVASGFFVLVGQPSSVRADGLNPTPGQVLPEETSGTKEGDLSEKPGDTVLTQAKPE 80   Streptococ...
WP_016397573       1 MKFNPNQRYTRWSIRRLSVGVASVVVASGFFVLVGQPSSVRADVVNPTPGQVLPEETSGTKEGDLSEKPGDTVLAQAKPE 80   Streptococ...
WP_016398960       1 MKFNPNQRYTRWSIRRLSVGVASVVVVSGFFVLVGQPSSVRADVVNPTPGQVLPEETSGTKEGDLPETQGDTVLTEVKPE 80   Streptococ...
WP_000671393       1 MKFNPNQRYTRWSIRRLSVGVASVVVASGFFVLVGQPSSVRADGVNPTPAQVVPEETSGTKEGDLAETQGDTVLAQAKPE 80   Streptococ...
2_ncbifamImport    1 MKFNPNQRYTRWSIRRLSVGVASVVVASGFFVLVGQPSSVRADGLNPTPAQVLPEGESVTKKGDLAETQGDTVLAQAKPE 80  
WP_000671388      81 GVTGNTNSLPTPTERTEVSEETSPSSLDTLFEKDEEAQKNPELTDVLK 128  Streptococcus pneumoniae
1_ncbifamImport   81 GVTGNTNSLPTPTERTEVSEETNSSSLDTLFEKDEEAQKNPELTDVLK 128 
WP_000671366      81 GVTGNTNSLPTPTERTEVSEETNSSSLDTLFEKDEEAQENPELTDALK 128  Streptococcus pneumoniae
WP_016397573      81 GVTGNTNSLPTPTERTEVSEETNPSSPDTLFEKDEEAQENPELTDVLK 128  Streptococcus pneumoniae
WP_016398960      81 VVAGNTNSLSTPTEGTEVSEETSPSRLDTLFEKGEETQENPELTDVLK 128  Streptococcus pneumoniae
WP_000671393      81 VVAGNTNSLSTPTEVTEVSEETSPSRLDTLFEKGEEAQENSELADVLK 128  Streptococcus pseudopneumoniae
2_ncbifamImport   81 VVAGNTNSLPTPTEGTEVSEETSPSRLDTLFEKGEEAQENPELTDVLK 128 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap