Conserved Protein Domain Family
RsaX20_sORF

?
NF038026: RsaX20_sORF 
putative metal homeostasis protein
Members of this family average just 38 amino acids in length, but are widely conserved among species of the Gram-positive genera that include Staphylococcus, Enterococcus, Leuconostoc, and Lactobacillus. Expression of an RNA designated RsaX20, which encodes a member of this family, was studied in a Staphylococcus aureus of possible structural RNAs, and shown to be controlled by Fur-like transcription factor Zur. The broad conservation of the coding region across multiple species and protein-like pattern of amino acid substitutions in multiple sequence alignments strongly suggests that that members of this family are indeed translated into functional proteins.
Statistics
?
PSSM-Id: 411619
Aligned: 54 rows
Threshold Bit Score: 31.1146
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_009853392     4 KVDLASAYRRLKSPNIKTRKRALKIIHDYKRF 35  Streptococcus gallolyticus
WP_004902899     4 KQDLSSAYRRLKSPNAKTRDRALKLIKEYKQR 35  Leuconostoc citreum
WP_013232028     4 KNDLSSAYRRLKSPNAKTRDRALKLIKELKAK 35  Leuconostoc
3_ncbifamImport  1 KTDLSSAYRRLRSSNRKTKKRALKIIKAHKKN 32 
WP_011672827     3 KENQSSAYRYLKSPNVKTKRRALKIIKEIKKN 34  Pediococcus
WP_018579408     2 KNDRATAYRNLKSPNLKTRKRALRILKTYTKK 33  Erysipelothrix tonsillarum
WP_014214731     3 KTDLSTARRMLKSTNIKTKKRGLRVIKAVKKQ 34  Pediococcus claussenii
WP_010018589     3 KMNVATAYRNLKSPNLKTRKRALRAIKDSKKK 34  Companilactobacillus farciminis
WP_003776842     4 KEDLAVAYRLMKSPNKKTARRGLKMIKQHKKK 35  Alloiococcus otitis
WP_016822819     3 KTDVATARRQLSSPNKVTRRRALRTIKAAKRA 34  Paenibacillus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap