Conserved Protein Domain Family
CRR6_slr1097

?
NF038024: CRR6_slr1097 
CRR6 family NdhI maturation factor
The protein Slr1097 and its functionally equivalent cyanobacterial homologs are required for proper maturation of NdhI, a subunit of NADPH dehydrogenase complexes, so that NDH-1 complexes can assemble properly. The related protein in the model plant species Arabidopsis thaliana is known as CRR6 (chlororespiratory reduction 6).
Statistics
?
PSSM-Id: 411617
Aligned: 47 rows
Threshold Bit Score: 214.336
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010871386      5 TVTPEQLSSLDLSPVQSWLERAIslnlnridESALATIEKQVQFDIQFAREEGDPRELSEIPEVRLWFIRLDSVYPWFPL 84  unclassified...
WP_017324362      6 VLTADAIANLDLSAGHAIVETLL---------TNPKGCAQQLQCAIDYPRAEDDPRELSEISEVRLWFVRWDVAYPWLPY 76  Synechococcu...
WP_011431052      6 HLPAKAIQALDLTPGHELVKTLM---------ADPVGAAQQVQCAIDWPRSPDDPRELSEIPEVRLWFIRWDTVYPWMPY 76  unclassified...
WP_011242755      6 VLPADAIAQLDLSPVQTALPELK--------TADWLTLEQQVCLKIQWPRSEDDPRELAEIPEIRLWFIRLDATYPQFPL 77  Synechococcus
2_ncbifamImport   1 RIEQGAVERLELNAVGLQIEQLA---------SDPLANARQIRFEIDYPLAEADPRELPEVQEVRLFFIRLDARYPWLPY 71 
WP_007097408     11 NIDARAIQELDLSPLQAWMEQPL---------PERLKAGAVVELRYAWPRDADDPRELSECPEPRLWALRADAQHPWLPL 81  Synechococcu...
WP_011932578     11 TVTADAIQRLDLKALVQWMDQPL---------SKLLNNGAVLELSYEWPRPPEDPRELSECAEPRLWALRADARYPWLPL 81  Synechococcu...
WP_011360395      5 LIDAESIRRLDLSPLRIWSDQPL---------KDLLKQGPILELNFHWPRDPEDPRELAECPEPRLWSLRADARYPWLPL 75  Synechococcu...
WP_006910187      2 QVGPAAIAALDLSPLAAWAALSP---------EQLLQHGGSLDLSFEWPRQPDDPRELSEIPEVRLWCLRADAAMPWLPL 72  Cyanobium sp...
WP_010306898      2 LIAQQQVLERSLAPLEPWFSLEP---------EALLQQSGSLELNFEWPRASDDPRELSEIPELRVWSLRADALCPWLPL 72  Synechococcu...
WP_010871386     85 CLDWQAGEFTRYAAMLVPHEFHRVDGIQFNPEALDLFIMGRVFVLADWLKKY--QLPAQFRLKSLAQLLGYDLDDNFLAQ 162 unclassified...
WP_017324362     77 FLDWRGGELARYAAMLVPHQFSQREGIQFNPEGLEIFVMQKIFVLLDWFKDK--DFGSTADVRNMAKVLGYDIAPEFFQL 154 Synechococcu...
WP_011431052     77 FLDWRSGELARYAAMLVPHQFNPREGIVYNPEALEIFVYQKIFVLMRWFKQQ--KLGSVSMLRDMALVFGFEVQPEFLSL 154 unclassified...
WP_011242755     78 LVNWQSGELVRYAAMLVPHQFSRNEGLQFNPEALAIWVNHKIFYFAQQLADR--GLSGSSRLKNFAQILGFEIDESFFEL 155 Synechococcus
2_ncbifamImport  72 LLDWRTGELTRFAAMLVPHQFSAKDGITFAPEAMEIFVMHKIFVMADWLSSK--GIANRSELRYLAQALGYDIDAEFFEL 149
WP_007097408     82 LLERSGGNLAQHVAMLVPHDFSPSEGIRFDPQALELWVTQRLMLLDHLNRGQ--QQSQRGNLNQMAATLGYELDPGFWAL 159 Synechococcu...
WP_011932578     82 LLDRPKGCLIQHVAMLVPHDFRPSEGIRFDPQALELWVTHRLMVLDQLGAEAgvPGHQRGNLSLMAASLGFELDAGFWEL 161 Synechococcu...
WP_011360395     76 MLERDRGSLIRHVAMVVPHSFNRTEGLRFDPQALELWITHRLMQLDDLCQEQl-DRTMRGNLSQMSAALGYELNDSFWSL 154 Synechococcu...
WP_006910187     73 LIERSSGQLTRHVAMLLPHGFSRGEGIRFAPEALELWITHRLFLLDAWSRSR--GLQCRQGLVQMAAVLGLEVDPAFWQP 150 Cyanobium sp...
WP_010306898     73 LLERSSGQLTRHVAMLLPHSFSRSEGIRFAPDSLELWMTHRLFLLDHWSRGQ--GLNCRGNLEQMAAVLGFELDGSFWQG 150 Synechococcu...
WP_010871386    163 L 163 unclassified Synechocystis
WP_017324362    155 L 155 Synechococcus sp. PCC 7336
WP_011431052    155 W 155 unclassified Synechococcus
WP_011242755    156 L 156 Synechococcus
2_ncbifamImport 150 L 150
WP_007097408    160 L 160 Synechococcus sp. RS9916
WP_011932578    162 L 162 Synechococcus sp. WH 7803
WP_011360395    155 L 155 Synechococcus sp. CC9902
WP_006910187    151 L 151 Cyanobium sp. PCC 7001
WP_010306898    151 L 151 Synechococcus sp. CB0101
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap