Conserved Protein Domain Family
AztD

?
NF038015: AztD 
metallochaperone AztD
Proteins of this family are components of the AztABCD zinc-uptake system. AztC, AztB, and AztA are the extracellular solute-binding protein (SBP), permease, and ATP-binding protein, respectively. AztD is a zinc chaperone to AztC, and it may store zinc in the periplasm for transfer through the AztABCD transporter system.
Statistics
?
PSSM-Id: 411608
Aligned: 28 rows
Threshold Bit Score: 579.589
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_112969460  34 WRLFVADHSLPVVHAIDLASGREIGRFDLKGYAALSLSDTGRTVFAVQGEENVVHAIDTGIALSDHGEHRDLEVAPPKLI 113 Rhizobiales bac...
WP_011747897  34 YRVFVGDHEKGQVTAFDLAEPDHRWTFPTTGQVKLYSVAGGAVVAAVQSDADTVQFIRSGISFHDHGDHRDIEVGDPAAI 113 Paracoccus deni...
WP_136886657  38 YRLFVGDHAGGQVTAIDLSDPDRRWTFETTGQTKLFPVAGGAVVAAVQSDDDAVHLFDSGISFEDHGDHADIEVTDPTAI 117 Paracoccus gaha...
WP_100188443  32 YRVFIGDHATPQVTALDLDNPDKRWTFNTAGQSKLYSVSNNDLIVAVQSDNDQVNFIQSGFHFHDHGAHTDIEINDPVAL 111 Marinomonas sp....
WP_136792526  28 WRVFVADHAAPRITALDLSSPETHWTFETTGPSKLYATAGGEGIVAVQSDHDSVAVLNSGVRLESHGDHSDIAVQPPA-V 106 Cereibacter cha...
WP_100163674  21 WRVFIADQEMGRVTALDLSAPDNRWQFDLAGPSRLYVSPTGGVVVAVQSDHDRVDFLSSGIALETHGDHADIKVEEPAHL 100 Pseudooceanicol...
WP_119273027  13 WRVFVADHSQATVRAIEVKSGKILATISTLGPATLHKSASGKTVFAVQSDADRVSAITSGVALDDHGDHGDLKLSQPYLL 92  Phyllobacteriac...
WP_086468698  27 WRILVGDHTEPKVTALDLATGDELASFPLASPASLY--ATGGTVFAVQGAGNQVSAIRSGITIEDHGDHGDIDIADPSLV 104 Devosia lucknow...
WP_040032091  31 WRLFVADHDKPVVNVIDALDGDKLTSFDLKGPAALYRSESGATVYAVQGSAGTVSMIGSGISFHDHGDHADIDIDEPKLL 110 Pectobacterium
WP_100556774  32 WRLFVSDHAEPVVNVIDALDGDKLDTFKIKGPASLYRSESGETVFAVQGSAGAVSAISSGISFHDHGDHADIDVDDSKLL 111 Brucella/Ochrob...
WP_112969460 114 GTTIKGEKPGHVVTHGDDVAIFYDRTDRFDLLKESSLLQ-EKPEPKAVNTIAAHHGVAVPMGNHLLVSAPNmQAPVKEGE 192 Rhizobiales bac...
WP_011747897 114 DASLTGPRPFHLVEHDGKVVLNYDQGGYAEILDGHALAE-GKAEPGRFPQARAHHGFVAPLGGNWLSTVAS-DEKVEGDA 191 Paracoccus deni...
WP_136886657 118 DTVLTGPRPFHLVDHDGQVVINYDTGGYAEVIDGAALAR-GRIDPQRFPQARAHHGFVAPLGDAWLSTVAS-DEEVTGDA 195 Paracoccus gaha...
WP_100188443 112 KKVLQGPRPFHLVEHDDLVSINFDKGGYADVLDGHELTE-GHIEVTRVQQNHAHHGFVTPWEDNWLSSIAS--NEAEEGH 188 Marinomonas sp....
WP_136792526 107 TGQIEGPRPFHVVSHDGIMAINFDKGGYATLLPQAAAVD-GQLEGKAFCQSRAHHGFVAPMGNKMLSTVAS-EAPVEGDA 184 Cereibacter cha...
WP_100163674 101 DTALEGPRPFHVVTHDGVTAINFDRGGYVAMMEDSDIL--GSGESEQFKLNRAHHGFAVPMGDYIIGTVAS-DAPVEGDG 177 Pseudooceanicol...
WP_119273027  93 NATAKGAHPVHFVEHDGRIAIFHDGDGTAQLVSEGQFAK-GKLAPQVIKTASPHHGVAVPLGGKTLVSIPH---PHDPDA 168 Phyllobacteriac...
WP_086468698 105 EGVLTGEKPAHFVEHDGQVALFFDGSGLVDLFSPAGWVEnGAPEVTRLDSGTPHHGVAIPWGDYTLVSVAD-----SEDE 179 Devosia lucknow...
WP_040032091 111 KTQLTGGKPGHFVERQGKVAQWFDGERYTMVYSEAAALD-GVNDAKRVFVSAPHHGVAVPYDNHAVVSVPN---PEDASK 186 Pectobacterium
WP_100556774 112 NVEWTGTKPAHFVERQGNIAQWFDGEDAARFFTEKAVLD-EKPDVKTANVVAPHHGVSVPYDSYAVVTIPN---PDDASK 187 Brucella/Ochrob...
WP_112969460 193 LPPRLGLRVLDRDGRQIGDVAPCTGLHGEATSARLVAFGCEEGVLIARPGGaEGPSVEMLAYGASLPRG-KVSTLLGGRS 271 Rhizobiales bac...
WP_011747897 192 SVPRLGLQAFDAEGNPAGNLATCTGIHGEAFSGAYLAAGCKEGVLTVKAGA-NGSEYKLLPYPADLPQGvTTGTLLGSTG 270 Paracoccus deni...
WP_136886657 196 SVPRLGLQAFDAEGQPTGDLAPCTGIHGEAFSGAYLVAGCKEGVLAVTTGS-DGPVYEMLDYPADLPQDvTTGTILGSNA 274 Paracoccus gaha...
WP_100188443 189 APPRIGLQAIKTDGTPAGDLQTCTGLHGEAFSGAYLTVGCKEGVLAAKAGK-NGTEYKMLPYPADFPKGeTTGTLLGSKS 267 Marinomonas sp....
WP_136792526 185 APPRIGLQAFDPAGTPVGEVATCTAIHGEAFSGAYLAAGCEEGILTVQETA-DGPRFAMLPYPTEFPEG-TTGTLLGSTA 262 Cereibacter cha...
WP_100163674 178 APPRVGIRAYNRDGQPAGELQTCTDLHGEAFSGAYLTAGCKEGVVAVTLAD-GTPSFSMLPYPEDFPEG-HTGTLLGSHA 255 Pseudooceanicol...
WP_119273027 169 LP--IGMRLLGEKGEALAD-HACPDLHGEASSGRLVAIACAKGLIFVDAQK-KEPRITVIPYPATLPDG-KATTLRGAKS 243 Phyllobacteriac...
WP_086468698 180 KKPRLGLDVIDPHGDKVGDTHPCPDLHGEATSGNLLAVGCGDGLLIVSGSG--EPSVEKIDY-AGLPEG-KVTTLVGGQG 255 Devosia lucknow...
WP_040032091 187 RP--IGARVISLDSKTVGDNVACPGLHGSAGSGDTYALSCETGLLLITQKG-DTPEIRHLPYSSTLPKG-SVSTLIGGKG 262 Pectobacterium
WP_100556774 188 RP--IGARIVDFKGNKVGEDVACPGLHGSAGSGSIYALACDTGLLLIEQDG-DKPVIKHLPYGKSLPEG-SSSTLIGGKG 263 Brucella/Ochrob...
WP_112969460 272 MQFFLGNYGEDKLALIDPDNTDaPYRIIDLPTRRVDFVLDPAKFQNAYILTEDGRLHLLDTVKGEIVRSETVTEPYSKDG 351 Rhizobiales bac...
WP_011747897 271 IQVFLGNYGPDGLVVIDPVDEP-HYRYIKLPFRRVDFALDPAKPSTGYVLTEDGSLHRIDLLKAEIVASAKVTEPYSMDG 349 Paracoccus deni...
WP_136886657 275 IQMFLGNHGPDGLVVIDPVDEP-HFTRISLPFRRIDFALDPVRPAHAYVLTEDGSLHRIDMLAGEIEASANVTEPYSMDG 353 Paracoccus gaha...
WP_100188443 268 FQIFLGNYGKKSLAIIDPTEAP-YMQLVELPFRRVDFILDPVRLQNAYVLTENGQIHRINLLSGEIEKSTRVTAPYSMDG 346 Marinomonas sp....
WP_136792526 263 MQVFLGNHGADGVVVVDPVGEP-HMRRVTLPFRRVDFALDPQHPQRGWVLTEDGSLHSLNLLDARIEASATLTAPYSMDG 341 Cereibacter cha...
WP_100163674 256 MQSFLGNYGANSVVIIDPTAQS-PFTRVELPFRGVDFVLDPAKPQFAYILTEDGTLHRLNMLSGRIEQSEAVTEPYSMDG 334 Pseudooceanicol...
WP_119273027 244 LRYFIGNYGPDAIVLIDVSAKD-AFRLVKLPARRVDFIIDPEHSERIYVFTEDGSLHRIDAIKGEIVKSAKLTQAYSMDG 322 Phyllobacteriac...
WP_086468698 256 MQYFLGNYGADKVVIVDPAEET-PYRLVDLPTRRVHFVTDPIRPKFAYVFTEDGNLRRLDVVSGQFTAAVTVTEPYSMDG 334 Devosia lucknow...
WP_040032091 263 MQYFIGNYGPDRIVLIDPTEAQ-SFRLVQLPTRRVHFAVDPVRPKFAYVFTEDGKLNQVDVLKGEITKSVRVTEPYSMDG 341 Pectobacterium
WP_100556774 264 LQYFIGNYGPDRIVLVDPSEADgGFRLVQLPTRRVHFAVDPVRPKFAYVFTEDGQLHQLDVLKGEIVKSIKLTEPYSMDG 343 Brucella/Ochrob...
WP_112969460 352 HWRDPRPRLAVAGDDIAITDPRRSLIRLVSTQTLKEVRTIPVEGQPFALVAAGGSGASH 410 Rhizobiales bacterium
WP_011747897 350 HWNDPRPRIAMAGDEIVVTDPNAGLVRRIATEDLSERGTVPVEGKPYNIAVTGGSGVTH 408 Paracoccus denitrificans
WP_136886657 354 HWNDPRPRLAMAGDEIVVTDPNAGLIRRISTEDLSELGTIEVEGAPYNIAVAGGSGVVH 412 Paracoccus gahaiensis
WP_100188443 347 DWNDPRPRLAMAGDNIVITDPNAGLIRLINAKDFSESKTINIEGIPYNIAVAGGSGISH 405 Marinomonas sp. BSi20584
WP_136792526 342 HWSDPRPRLALAGSDVLVTDPREGVLRVVDRETLAETAQIPLEGAPYNVVVVGGAGLAH 400 Cereibacter changlensis
WP_100163674 335 HWRDPRPRLAMAGDSLLMTDPRASVLRVIDPTTMSEVQAVPVEGLPYNLVAVGGSGLVH 393 Pseudooceanicola lipolyticus
WP_119273027 323 HWRDPRPRLAVAGEEIVVSDPLAGLLRIANPETLEEARVIDVEGMPYGIVAIGGAGEVH 381 Phyllobacteriaceae bacterium SYSU D6...
WP_086468698 335 DWSLPRPRVAVAGDVIAVTDPSEGKVHLVDAGTFEITGDIPVSGLPYTIVAIGGAGTIH 393 Devosia lucknowensis
WP_040032091 342 HWNDPRPRIAVAADNIYITDPLKSKIHVLNAADLKETSTITVQGHPFNIVAVGGSGKVH 400 Pectobacterium
WP_100556774 344 HWSHPRPRIAVAGDNVVVSDPLKGQLHLVNANSFEKAGDIDVAGKPFNIVAVGGSGKVH 402 Brucella/Ochrobactrum group
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap