Conserved Protein Domain Family
darobactin_RiPP

?
NF038004: darobactin_RiPP 
darobactin family peptide antibiotic
Darobactin, discovered in the genus Photorhabdus, is a peptide antibiotic, made from a ribosomally translated precursor, and modified by the radical SAM/SPASM peptide maturase DarE. Darobactin A is the founding member of a new class of antibiotic that appears to target BamA, a component of the outer membrane beta-barrel assembly machine. It is seven amino acids long, Trp1-Asn2-Trp3-Ser4-Lys5-Ser6-Phe7, with two crosslinks, one from Trp1 to Trp3, the other from Trp3 to Lys5. Homologs of the darobactin A precursor are encoded in various strains of Photorhabdus, Yersinia, and Vibrio.
Statistics
?
PSSM-Id: 411597
Aligned: 26 rows
Threshold Bit Score: 56.1708
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CNH58066             20 KSKLKSLEESFKNNPLYITSNEIDEIKNNTLHSKITAWSWSRSFA 64  Yersinia pseudotuberculosis
WP_050084538         21 KGKLQSLEESFKNNALYINDNEIEKIKNNTLRSKITAWNWSRSFA 65  Yersinia intermedia
WP_049603591         20 KAKLESLDESFKNNTLHISDNEIEKIKSNTLRSKITAWNWSRSFA 64  Yersinia aldovae
WP_005162253         24 KTKLEALDESFENNSLHISYDEIEKIKNNSLKSKITAWNWSRSFA 68  Yersinia enterocolitica
CNL34432             20 KSKLQSLGESFSHHSLYISNNELDKIRNSLAKTKITAWNWSKSFT 64  Yersinia aleksiciae
RKS57093             12 QELLNSLVASFKGTELSITEKALDELSNNTEIPEINAWNWTKRFP 56  Photorhabdus asymbiotica
WP_152962143         12 QEALNSLAASFKETELSITDKALNELSNKPKIPEITAWNWSKSFQ 56  Photorhabdus
OCA52811             12 QEALNSLAASFKDTELSITERALDELNNKPKIPEITAWNWSKSFQ 56  Photorhabdus namnaonensis
CeBiTec:PNC201_07215 13 AEKLDALKASFSDQTLNIANVDQSRVDSIAIAPPITAWNWSKSFE 57  Pseudoalteromonas sp. NC201
KZN44480             13 SEKLDALKSSFSNQTLNIANVDQARVDSISVAPPITAWNWSKSFE 57  Pseudoalteromonas luteoviolacea H33
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap