Conserved Protein Domain Family
HYExAFE

?
NF038001: HYExAFE 
HYExAFE family protein
This uncharacterized protein is named for its best conserved region, the motif HY[ED]xAFE, found near the N-terminus. It appears to limited in taxonomic range to members of the Planctomycetes.
Statistics
?
PSSM-Id: 411595
Aligned: 97 rows
Threshold Bit Score: 153.447
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
TVQ81667          2 QRRHHYEQAFSAYLRRHRIPYIGVDEARKALLPddavpgvsapGTDaptraLKSFDFVIYadpsrpeaPD-ANLLIDIKG 80  Phycisphaera...
TKJ34271          4 FSPNHYERAFENWLLDNRIQYVAVDEHKRTAFG----------HSD-----IKSFDFLLYp-------PGgKTVIAELKG 61  Planctomycet...
RKY11361          3 IWLTNYEQVFENWLVENRVQYVVVDQHKRRLFA----------RSR-----IKSFDFLLYp-------ANsAPVIAEVKG 60  Planctomycet...
7_ncbifamImport   1 SFPNHYERAFENWLIDNRIEHVAVDEHKRTAFG----------HSD-----IKSFDFLLYp-------PEkPIIIAEVKG 58 
OHB68138          4 FSPNRYERAFESWLLDHHVRYVRSDEHRRLGPS----------YKG-----IKNFDFLLLp-------RPdRKVIVEVKG 61  Planctomycet...
KAA0215740        3 GERNHYERAFSTLLKEQGVKALAVEERRRPALE----------GRV-----LKHFDFLVN--------GSeKVWALDLKG 59  bacterium
RPH37592          4 YSPNRYERAFENWLLDHHVRYVRSDEHRRLGPS----------YKS-----VKNFDFLLFp-------RPdRKVIVEVEG 61  bacterium
WP_146662534      3 SQSNDYEIALESWLIENRLKYVAVDQQKRNHFA----------RNS-----VKSFDFLLYnnraglcpDAaDMIVAEVKG 67  Anaerohalosp...
OQY03997          4 TLANIYEQAFECFLTENKLPFLWIDQSKCLAFA----------DGP-----VKNFDFLIGp-------DTdSPILVELKG 61  Planctomycet...
WP_146683053      4 AGKNHYEQAFEAYLSVNSVVYSRIRQESRFCWK----------ERK-----IKSFDYFVRl-------ANgPHMALEVKG 61  Limihaloglob...
TVQ81667         81 RKVARrSPRAdplaPGRLENWVTREDIDSLTIW----EQLFGDGF-----RAAFVFLYWC-EAQ-PPDGlFQQV-FDHRA 148 Phycisphaera...
TKJ34271         62 RTFKGaSLAK----LTGFECWVTAEDVDGLTKW----QQVFGEDH-----QALFVFAYKI-ENIdVDFD-GIDV-FDFDQ 125 Planctomycet...
RKY11361         61 RRFKGkSLAA----LAGLECWVTMEDVRGLIRW----ERVFADGF-----QGAFIFAYEF-ANVdVETD-GRDV-YDFQN 124 Planctomycet...
7_ncbifamImport  59 RKFKGtSLEK----LAGFECWVTIGDVEGLTRW----QQIFGEGH-----QAIFVFAYKM-ENVdVDFD-GRDY-FDFDA 122
OHB68138         62 RTFAGtTLAG----LTGLDCWVTLDDIESLQVW----KQALGRDH-----EAVFVFAYHA-TQAdVDFD-GCDS-AAFHL 125 Planctomycet...
KAA0215740       60 RR------------QTP---WITRTDLFSMMGW----QKLLAEKA-----SLAFVFAFMG-HGR-RLDD-LPALaWDCAG 112 bacterium
RPH37592         62 RTFTGtTLAP----RTGLDCWVTVDDIQSLQVW----RDALGHDH-----EAIFVFAYRV-AKAdVDLD-GCEA-VTCGL 125 bacterium
WP_146662534     68 RLYKGtNFAS----LSGLQNWVTQDDVIGLEDW----QSVLQESSarqkvEAVFVFAYRF-EKIdVETD-GRAT-YDFCD 136 Anaerohalosp...
OQY03997         62 RTFKGsSLAG----LKGLDGWVTFADVRSLSRW----LGQFQTDTpa--aRAVFVFAFRF-ANMdIETD-GWPH-YDYSG 128 Planctomycet...
WP_146683053     62 RSFYGkTLDG----LKGAQSWVSADDIEGLDRWlcvsQDIQAAGF---------IFAYLIkRAD-FDGN-GAEI-FEFDG 125 Limihaloglob...
TVQ81667        149 RWYAMRTITLTDYKAHMRLRSPRWGTMHLPTADFEELS-QPLLR 191 Phycisphaeraceae bacterium
TKJ34271        126 IRYLFFCIRLDDYRKFMKRRSPRWQTVTLPAGRFRDCA-VHINE 168 Planctomycetes bacterium B3_Pla
RKY11361        125 SRYMFYAVRLNDYREFMKVRSPKWQTVTLPAAKFREFA-IPVRE 167 Planctomycetes bacterium
7_ncbifamImport 123 NKYLFFCVKLDDYRKFMKRRSPKWQTVTLPAGKFREFA-VSIND 165
OHB68138        126 DRYVFFCIRLDDYVEHMKRRSPRWHTMTLPAESFRRCA-SSLSA 168 Planctomycetes bacterium RBG_13_62_9
KAA0215740      113 ARYHFCLMELQDAQRLARPRSARWGTFGFEWKAFCRCV-RGLED 155 bacterium
RPH37592        126 DRYTFLCLRLDDYLEHLVRRSPKWRTVTLAADNFRKCA-LSPLI 168 bacterium
WP_146662534    137 NRYAFLAVKLDDYRKLMKVRSPKWKTFSVPAADFRQIA-KPLGQ 179 Anaerohalosphaera lusitana
OQY03997        129 ERFLFLAILLQKYAGAMKIRSPKWQTVVINAADFRRHAaKTFKN 172 Planctomycetales bacterium 4572_13
WP_146683053    126 RYYAFYYVDFNRYCNSMKRRSSSWRTVYMPAASFRQAA-VETSA 168 Limihaloglobus sulfuriphilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap