Conserved Protein Domain Family
mutacin_prime

?
NF038000: mutacin_prime 
mutacin-like lantipeptide
MutA', a paralog of the nisin-like lantibiotic mutacin precursor MutA, is a lantipeptide of unknown function, encoded in Streptococcus mutans within the same region. It is not required for mutacin function.
Statistics
?
PSSM-Id: 411594
Aligned: 2 rows
Threshold Bit Score: 122.856
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_024785189  1 MLNTQLLEVLGTKTFDVQEDLFEFNITDTIVLQVSDSPGTHSKVGSFSICPPRKTSVSFNSYCC 64  Streptococcus mutans
WP_002289978  1 MLNTQLLELFLSDTLDVREDLFDLNITDTAVIQSNDSPDTRSRVGSHSICPPRKTSASFNSYCC 64  Streptococcus mutans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap