Conserved Protein Domain Family
RND_1

?
NF037998: RND_1 
protein translocase SecDF, variant type
Members of this family are identified by TCDB as belonging to 2.A.6.4.4, a variant 12-TM type SecDF, as found in Spiroplasma, Mesoplasma, and Acholeplasma.
Statistics
?
PSSM-Id: 411592
Aligned: 8 rows
Threshold Bit Score: 1090.2
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_027875315    9 KKISQVFCLILIISSLVISIVFSSISITNNTNLNTRYSGGYEALVEVYDQKQNSTNENSlnPNGDAYAAAESLQNKLSPF 88   Mesoplasma ch...
WP_041618275   14 KPIFKTIAMLIIICSLILGMFFSSLKFSENIKLGSDFKGYYSALVAVDNLNEESSTNGQ--PNGDSSEGAKALNERLNPM 91   Spiroplasma d...
WP_069116211   14 K-IWRVFIVFVLLASLFVGIFFSSQNFLDNYRLGSDIKGYYSALVAVNNANEKETANGQ--PNGKAADAASVLEQRLNPM 90   Spiroplasma h...
WP_026389768    8 KKIVHIFIMFMIIASLIIGIVFSLGGAINDNKLGSRFNGGYEALVGVYNNTKEQDDNENl-PNGDSDEGARALEKKLSPF 86   Acholeplasma ...
WP_104207635    9 RKILNILCIFIIVIGLAISIVFSSMSVSANTLFNSRYSGGYQSLVEVYDLNKDQETGSSqiANGDARVAAKSLETKLSPF 88   Mesoplasma co...
WP_023025645    9 KKIAQSLCLVLIVFSLIISIVFSSFSIANKTNLNTRYSGGYDALVEVYDEKQNATQGTSt-PNGDARLAAESLQTKLSPF 87   Mesoplasma fl...
WP_047791328   22 KLIVRIFVLLILTCAMIVGAVFSGEIFSYSYKLGIAYSGGYQVQINVFDTTVENPDGT---PNGDNKKGLDLLRNKLDPL 98   Spiroplasma e...
WP_071937279   25 RLIIRIGTLIVLIIAMIVGAFFSADSFRYSYRTGIVYSGGYQAQIDVFDKRDPNYSPDT--PNGDSKKGLELLRNKLDPL 102  Spiroplasma c...
WP_027875315   89 SDNTVDVKVVGKHRVSVRATKEQYQNNpTLFINAIEQDGGLLALtkdsKGNYDDILFNd-ETMNTVTGSnvytdnk---i 164  Mesoplasma ch...
WP_041618275   92 GNNQIIIEKAGKNFLKVLSPVEAYQSE-TIFKNQIQKNGGIVLLn---SETYKDLQIT--GTDTIERKG----------- 154  Spiroplasma d...
WP_069116211   91 GTNQIIIETAGDNYLKVLSPIDAYDSQ-TQFRNQIQRNGGAILL----NENYEDLQLEidKDGKVTRSG----------- 154  Spiroplasma h...
WP_026389768   87 SDNTIEVTKTGNSRLTVRASKDAYSNNeNFFVDAIEQNGGLVIL----NSAFEDVLFDs-TIMKKIDKTvldgegn---v 158  Acholeplasma ...
WP_104207635   89 SDNTVDIKVVGKNRLMVTSIKEQYGSNqTNFEHAIEQDGGLLAL----NSNYKDILFDd-STMTKVKTTgvfddnk--qi 161  Mesoplasma co...
WP_023025645   88 SDNTIDVKVVGQHRVSIRATKEQYQNNpRLFINAIEQDGGLMAFtq-tNNIYTDILFDd-TAVKKITASengiydsnnei 165  Mesoplasma fl...
WP_047791328   99 NNSNLYLQTLGHNGLELIAGKDLFKSY-ADLKTDIQRLGAIYLM----KGDGTDLLVSd-----KERTP----------- 157  Spiroplasma e...
WP_071937279  103 SNQNLYLQTLGRNSVDVIVGKDMFKSY-SELSKTIQRLGALYLT----DSKGKDLLISd-NNGTKERTP----------- 165  Spiroplasma c...
WP_027875315  165 snkiaISDIFGSVKYTPdrseSNSGAQNSPFLTFEEgANGTYLQKLTASSTSTE-GTTTTPS-LTLISSFETVLNNIREY 242  Mesoplasma ch...
WP_041618275  155 -----INEYFTGAKASS----IKDSNLKEPAISYSL-NGDTFKTLLTGGSEEQE-GGGSSSLgLFILLDADGFYNDIRNY 223  Spiroplasma d...
WP_069116211  155 -----INDYFSGAQVTT----VTTASAKNPAIEFKL-NGSKFSSMFTEQKTSIN---------MELMIDADGFYNDLRNF 215  Spiroplasma h...
WP_026389768  159 tdkvkISEIVGNVKAEA----VKVGTSNQPFLNFDI-SETEYLSKIVAASETEQ-----TPV-LNMITSIETLLNNLRGY 227  Acholeplasma ...
WP_104207635  162 kekiaISDIFGDVNYSPepdpSGA-QKNAPFLNFSEgKKSGYLDKLASSTTAEGeNAPTNSQkLTLISSMQTIINNLREY 240  Mesoplasma co...
WP_023025645  166 tnklaISEIFGSVKYTPdrseSGSGQQNSPFLTFEEgSNGSYLKNLTAATTATE-NAPATPAnLTVISSFETILNNLREY 244  Mesoplasma fl...
WP_047791328  158 -----LSDVISGAE-------AGIDKTRHPIINLNIkDQAKWDAIIKSLTPSQG-----SPEpLYIWTDIGQFIDELRH- 219  Spiroplasma e...
WP_071937279  166 -----LSDVISGSV-------TGVDQARRPIITLEIkNQQKWDSIINSLKPSEG-GRQAQP--LYIWTDIGQMIDDLRH- 229  Spiroplasma c...
WP_027875315  243 FLQTPNQNEiDSyIEAYYDGIITPIIQVYTSSStdSSTRAVIDDFFTFSYrRQSGEMATTSLISGDIYPwwsenq----- 317  Mesoplasma ch...
WP_041618275  224 YNLIKGDKE-DR-IEEFFKVIINPMRDIYKDSSksDKVKQILFDLFYGEW-SEKTSSGVNVTYRGSLIDp---------- 290  Spiroplasma d...
WP_069116211  216 YASVNKDNNrEN-VDSYFTNIIEPLRIKYNDSNttDIQKKALDDLFAGRY-KSVDTGGYERYISVNLLN----------- 282  Spiroplasma h...
WP_026389768  228 YNLGTTEDEmDDyVSAYWNGLISPLQTAYNKLS--TKEQNVLDDFFGGTY-ITTGTTGLQVENVVSLMD----------- 293  Acholeplasma ...
WP_104207635  241 YTLAPKSINqDDyLLSFYKGVIIPAQTVYKSGD--DNVKAILDDFFAINY-KVKHDDGETIK-SGSLIGdkldfwwenns 316  Mesoplasma co...
WP_023025645  245 FLQAPNENSlDTyLENYYRGVIQPILSFYSSTDttAQQRAVIDDFFSVSYmTSSGQMQSASLISGSFNKwwtdsasn--e 322  Mesoplasma fl...
WP_047791328  220 -----DTDNiQA-IATNFNVNILPNLSGTDNIN--------VRSIFDVSY-KDAGQGGIIVY--RNLLD----------- 271  Spiroplasma e...
WP_071937279  230 -----DTDNlQA-IATLFSVDIRSKVSSTDWTN--------IYHIFDMEY----YDNGTAQIQPGNLLD----------- 280  Spiroplasma c...
WP_027875315  318 ttfklqNLNRTIAIENLKALFygqyrqqtysdfnsTDNYQYLFTN-NVNKYVIDPNATTNDFlasgegiTEPGKYSGDFK 396  Mesoplasma ch...
WP_041618275  291 ------TSAPNNALLDSKGFL--------------EIVDTFKYVS-ETSKYVYDSNAVTKDF-------QTAGRYESKVK 342  Spiroplasma d...
WP_069116211  283 ---------PDVTRENFEEYI----------------QNHFEFLS-DTSKYVYDPNSKSEDFn------GTDAKYASPIE 330  Spiroplasma h...
WP_026389768  294 -------QTKIKSEQSLKSVLfqye------ngkiNTNKSFKFLNtNIGKYIYDPNSIAEDFmi---kdGKKGKYYDNLK 357  Acholeplasma ...
WP_104207635  317 nnhtiqGSDVQV-VRQLKGIIygtyd-----atntISNHEFSYIN-SASKYVVDSNSVTKDFn------DATGKYHEDFK 383  Mesoplasma co...
WP_023025645  323 qmlfnnSNNIELIVNDLKALLygtfe-----grtaPTNYTYNFVN-NVNKYVIDPNSKTEDFkkepengNPAGKYSENII 396  Mesoplasma fl...
WP_047791328  272 ------LATSGMSHPELVKVM---------------QEDSFRFTTvSLDKLVIDPNDKK----------AIKNQYIDPLR 320  Spiroplasma e...
WP_071937279  281 -------LALRYPISQVKEWM---------------EDSRFRFTTlPTNRLLIDPNDKA----------ATTNAYIDPLR 328  Spiroplasma c...
WP_027875315  397 FSSSVSN-QPQGLGIDGVAKILNKLILNdvl-fnVPSTSTSTFNIYLNEDIfnRNFIMINDTV---TQTGVPTPSETYss 471  Mesoplasma ch...
WP_041618275  343 LWTSANVeTPSTMRVDELFSEINPTILN------FAKEYQNSFNSQFLNNIk-TSYFLFDGTVt-eTKTGAGAGYIEN-- 412  Spiroplasma d...
WP_069116211  331 GYNRQGA-TVQLGKLADVFKALNGSIGSfw---kNQYVTVLNNEKKMANKL--NAYFLYAGTVy-gNVTNASYAYVDNtt 403  Spiroplasma h...
WP_026389768  358 VDAKLNKpSRDMGNIREAFKVLTSNLLGka--lfKDIKAGSKVNQYFDEKVf-DDYILLTETInpaTNVNSKAYIDTDa- 433  Acholeplasma ...
WP_104207635  384 FSLNQSA---PQMKIYTVADTINALIVKdillanIDPNKTEPFNQNLDSDIfsKNFIMANDEInymSTNSNDSSSNTYsk 460  Mesoplasma co...
WP_023025645  397 LGA-------QSMRIDEVAKVINDVMLSkv--lfAQKSSTSIFSQYLDQSIfeKNFIMINDSV---TQTGVASASETMsr 464  Mesoplasma fl...
WP_047791328  321 KYL----------------------------------TGIINYTPQLKDKY--KKYIINYNAI----NKGTTPGLNSN-- 358  Spiroplasma e...
WP_071937279  329 PYL----------------------------------QTIIEYNSALTEAY--KKYVINWNSI----KIGTGAVENSN-- 366  Spiroplasma c...
WP_027875315  472 ratfvpsaiyngntNELRVKMRSATIARTIEASISQTTQGFTFKVVNIKEFDPEITLYMLLASIIFLLILAIITMIFLLF 551  Mesoplasma ch...
WP_041618275  413 --------------NNLITKVDTETKSRVGASLFNASGKGFVFTVNSIATINGKVTNLMLISAIIFILIIIICMIVYMGF 478  Spiroplasma d...
WP_069116211  404 ------------nsLKIIFANQPESTARIGASVFNASTKGFIFTVNNISQVNPSITSLMLSLALIFLGVVALGLLIYAMF 471  Spiroplasma h...
WP_026389768  434 --------------NRLMVRSETYTKSKKTEATILQTTLGITFKVLSVSEFDMDITAVMFIVSVVFLIIIALAIMGYLIF 499  Acholeplasma ...
WP_104207635  461 kv--------sfisNQLKVAAKSATIAKTIEASIKQTTSGFSFKVIRTVAFNADVTLLMLIASLVCLLILSIITITYLLF 532  Mesoplasma co...
WP_023025645  465 atftps-vvyngatSQLRVKTRSATIARTIEASISQTTSGFSFKVIKLTEFNPEITLYMLLASIIFLLILAIFTMVFLVI 543  Mesoplasma fl...
WP_047791328  359 -----------------QIATSTDTEARTISNLVNGGLSGLKFVVRGHTTIPPVVSRNILNVSMIVLGIIAAAICVYLLI 421  Spiroplasma e...
WP_071937279  367 -----------------QITTSTETEARQISNLINGGLSGLEFTIRGYREIPPVVSANVFKISMIILGVLVLAIFIVLLV 429  Spiroplasma c...
WP_027875315  552 AYKLLGLYTLIIAVTSTFIVFFAPTIFGIAIGIEIYTLIFVMIGLVLESCILTIEAFKKHLNKEKRSISESMKLSNRENF 631  Mesoplasma ch...
WP_041618275  479 FYRILGLFSMIITLSIIGITLLSLSWFNLTVGPETIISAFILITLNMEIFSALFESMKESFFLKQRGLKTSFNISIKENI 558  Spiroplasma d...
WP_069116211  472 MYRILGLFMIVVILAIASLTLMSTTWFGLTLGVEAIIAIVIIISINLEIFSMIFENMKFNFYLKQRSIKTSYNISIKENI 551  Spiroplasma h...
WP_026389768  500 AYRLLGLFASILAFLAASLTLLVPVWFTLAIGPEIITSLIIVVGLVLDASFIYFESIKKNIYKDKHSIESSFKIAGKETL 579  Acholeplasma ...
WP_104207635  533 FYRLLGIYTLIIAVTSIVLTIWTPTFFGVAIGIETITLMFVALAIIIDSCVIFIEAFKKHLNVNKRSQIESFKLANKDTT 612  Mesoplasma co...
WP_023025645  544 AYRLLGIYTLIIAVTSVFITLFTPTLFGIAIGIELYTLIFIMLGLVLESCILTIEAFKKHLNKEKRSITESFKLSYKENL 623  Mesoplasma fl...
WP_047791328  422 YYRLFGFVAILTLAFTIILTLYFSSLLGVQISPESIAAVIIAFGIALEGNLLLFSRYKRERYQNGLPYEPAMKIANKQTV 501  Spiroplasma e...
WP_071937279  430 YYRLFGLIAILTLLFTIISTLYFSSLLKVEISPESIAALIIAFGLSLEGNLLFFSRYKRERYENNIPFEPAMKIANKQTI 509  Spiroplasma c...
WP_027875315  632 TIIVDSFILLLIPNLILFWVGSGSLKNFATVATVATAIILVLVVVIFRLLIWLTIKLDIFRKFPLLLPVDTKDINSGVAI 711  Mesoplasma ch...
WP_041618275  559 GIAADLVIALLIPTMCMFWISSNAIRSMAIMLAMGSFFTVLFTILIAIILFKLLMNSQLITNKAYLFALNTDFASQGNFI 638  Spiroplasma d...
WP_069116211  552 GLAVDVLVALVIPAISMFWIASNSIQSFAIIILMGVIFSFVLSLIFATILNKFAVFSNMFNNRPKLFALNTDFANQGKIL 631  Spiroplasma h...
WP_026389768  580 WLGIDAALVTLIPNVALFWIGSGALKNFATITSLGVMFALVFGIIVLRFMSRIVINTKWFKKYDWLLPIDTSQKIKSTFF 659  Acholeplasma ...
WP_104207635  613 SSIFDLTLLVIVFNIVLFWISSGSLKNLATIAVASSAITFILVIIIFRLFIWLTIKGDVMKKNPLLLPLDTSFLKNNYAI 692  Mesoplasma co...
WP_023025645  624 GIILDSFILILIPNLIIFWIGTGSLKNFATVATVSTAIILFLVIVVFRLMIYLTVKIQIFKNHPLWLPIDTKDIKSGVAI 703  Mesoplasma fl...
WP_047791328  502 AVFVDALVVLLVLGLSLFWAGTNNIKSFATILLVALIISLVMVFAVARIMYWIIIKLRWQEKVTWL-------------- 567  Spiroplasma e...
WP_071937279  510 AVFVDALVVLIILGLSLFWTGTNNIKSFATILLVGLIIAIIMVFAVARLMYWIVIKLHWQEKYHWL-------------- 575  Spiroplasma c...
WP_027875315  712 LEkVKLSKLEYHLIVLTNKEKVSSKELLKIKKISD----SIDKLKAKIENKEKEYEIKLINKNKDKNNKLDQKIqkLEKK 787  Mesoplasma ch...
WP_041618275  639 IN-YKITRLQNKISKLKSKSNFNKELLKKFEDRLNklneKLNFIKIKDEEKSNKKQLLIKEKINKKIDKYNLNI--EKLN 715  Spiroplasma d...
WP_069116211  632 LN-YKIRNLENKIEKNKAKGLDVSNLISKLEACQN----KIKLYEEKEEIKQAKLNAKYQEKVLARINALEQLKtkLASN 706  Spiroplasma h...
WP_026389768  660 NDfFK-KHYESKLEKLTSKDSLSSEQLIKIKKIKD----KVSHYSQKERDIIAKKNAAFIKKAEAKIAKFEKQNksLKET 734  Acholeplasma ...
WP_104207635  693 KQkIQLSKVEFKINMLTNKEKLSSKQLLKIKKMDD----QKTLLNKLILEKEELFKTKNIAKHKARILKLESKVlkENLQ 768  Mesoplasma co...
WP_023025645  704 RDkINLSKYEYQLNILTNKEKVSSKELLKIKRIND----LIEALKIKIENKEKEYNQKLINKNKEKTIKLNQKIesLEKT 779  Mesoplasma fl...
WP_047791328  568 ----DIPRFSLLTYFQQKKHPH--------QVVNG----EAQLLSDRFFALPTTDANEAAPNVPDQSKKPH--------- 622  Spiroplasma e...
WP_071937279  576 ----DVSRFSLWTWLVKKQSRTLAMDVKKVDSSAT------DPPPKTELNVTANGETELAASTQAENKKPK--------- 636  Spiroplasma c...
WP_027875315  788 SNK------KVR-WYKRDWINFLKVNKEVNLAISSKQESSVVEEAKNKRNQNWIFNINRILIIVLLVFSVIGGVVAATVG 860  Mesoplasma ch...
WP_041618275  716 KDKsakkiqSLN-FKISELIFLRDDQTQNIIEKEGEIEISPTEKLKIKTIEKNIKSGAKIISLFSIIMLSLSIVLGFVFG 794  Spiroplasma d...
WP_069116211  707 PKKank-ilKID-LKINEYKYILEDKTDDILTEESEIILQTEGKVKVKKYEKSIKTGSFIILFIMLIFAAVSGLVGGLFK 784  Spiroplasma h...
WP_026389768  735 KFKslnkliNSR----KDQNNFNKNYYEVKLANDNPEEIQVNEMIKLERK---VFKTGKIMAVIGVFMIAIGAIVGFTAG 807  Acholeplasma ...
WP_104207635  769 ETKtknpfiKFRlWIMKSVIVSRQISKSYSEAIIQQESNEVIQKIYESKQINNSLNVSKILILITLVLSIIGSILSMTIG 848  Mesoplasma co...
WP_023025645  780 EK-------KIR-WYKKDWISFLKVNRDVAKAVSTNTEGKVIEEVKTKRNQNWIFNINRIIIVLLLVFSVIGGVVAATVG 851  Mesoplasma fl...
WP_047791328  623 ---------KLR--FKPKFSLY---------------------------------NITKYSPIVGIILIIIALIIGFAGK 658  Spiroplasma e...
WP_071937279  637 ---------QIK---HGKWTFY---------------------------------NITKWTPIVGIILLIIALAIGFAGK 671  Spiroplasma c...
WP_027875315  861 PNYSNSFGKDNTYIVYGTYLND----FAGNNLdnv---------ktKIEEGSSENISNEFNNLIDSIENPTNDP------ 921  Mesoplasma ch...
WP_041618275  795 LNFDSTFGGRTDYTLWGDNTSElyykISDENF--------------DDYTHGNEDKLKEIYNYKTDLIEAHEKFkaensn 860  Spiroplasma d...
WP_069116211  785 PNYDSTFGNRTEYTMWGSKLEAmy---------------------nGIESFSSKSIDN--QELKDKVSKMVSDEqadyss 841  Spiroplasma h...
WP_026389768  808 PNLTSSFGKGNKFVLYGSTIDDtyesLSNNGQiqewvfdpnsklvqEIIDLKANSDQKNIQKLKDQGIMNINRPeelqgd 887  Acholeplasma ...
WP_104207635  849 PAYSNDFGKDKTFIIYSENLKS----FSNGQYsi----------vhDKIDEQNKTKAAELEELKNQIMNEPSSN------ 908  Mesoplasma co...
WP_023025645  852 PNYSNLFGKDNTYIVYGEYLYE----LPGNNFdnv---------vtKIAENQSEEQANAFQSEALRMANEKGHSdie-ag 917  Mesoplasma fl...
WP_047791328  659 ANIDSTIKPGTNITVASDIWRH------------------------------RDDATAEIQEMT---------------- 692  Spiroplasma e...
WP_071937279  672 ANIANSIKPGINITINEDLWGT----------------------------DGSKQVPDEVAIAKLK-------------- 709  Spiroplasma c...
WP_027875315  922 -SDDAYSAELGgRTVQF----IFDNNLTSLF-YSGYNSSS---NLNSIEWGTNYgaNLENNAEIDGKPYVQIELSNKTHf 992  Mesoplasma ch...
WP_041618275  861 lIDVVKLDETK-TVSEFlnyvFSDSFYVDYLaQNLSSSKAykkNNFTVSYGDKFifNDTTTGTATNQNWITLTVYTQNL- 938  Spiroplasma d...
WP_069116211  842 lNDSQKREKTAiIVYKFldivFSNPDYVNAV-TNSAGSRSyqnHNYYVSYGTNY--NYVSSAAADEVPWVTLSVITTDNt 918  Spiroplasma h...
WP_026389768  888 qYLEARNEWKAsVVADFyefiIFNNHLTDFVnYKESVGKL---ANVQIKYGPDFkqTGISLDKLSDVPYVSIQTTSSVEf 964  Acholeplasma ...
WP_104207635  909 -SDAKKSIELSaKTLEF----VYNNDLTKIF-VNKSVAKT---SNPVIIYGDDY-----VISNNSNVGWIQVRFSNRTSl 974  Mesoplasma co...
WP_023025645  918 aNDNEFVAWLSeYTVQY----VFDNNLVKVF-YSGYKGTT---SLNSIESGTTYgdQTENSSAENLMPYIQIELSNQTNi 989  Mesoplasma fl...
WP_047791328  693 -QELKHLQATRgYNFSF--------------------------NLYVI--------KADDMSMGQQLLVISTNISGSN-- 735  Spiroplasma e...
WP_071937279  710 -NQIEEYQQIThHNFSF--------------------------NIYVI--------KRQDSGNSNRILVVSTNITKGT-- 752  Spiroplasma c...
WP_027875315  993 gRTRTLLYSIFRGStILPGENNLTNEs-RGILGMFQIPFTAYGQILQIC-IAFGILLLILIVYILIRYKWTYYVALALAI 1070 Mesoplasma ch...
WP_041618275  939 -KQSAIIKRMFNNF-GVDKSVNIGSQ--SGFITKAINPATMLWTLEQIA-ISIAVIILALIIYILIRFKWTYYIAMIVSI 1013 Spiroplasma d...
WP_069116211  919 qSF--TVKNVFAEVgGFTKEQEINAN--GGFISKRIKPSSIVDMSIQMA-YGILTIVLALIIYIFIRFKWTYYIAMVIGI 993  Spiroplasma h...
WP_026389768  965 gTFKAWMRRIADN-------GKQTPTsaGGILGLSESPFTAYGQIKEVA-IMFGIILLALLVYMIIRFKWTYYVALALGF 1036 Acholeplasma ...
WP_104207635  975 aKNRLLMKKVLFDVnAIWQGGEIENTidKGILGMDQSPYTAIGQITQIL-IAMAILLLGLLVYIIIRFKWTYYVALALGV 1053 Mesoplasma co...
WP_023025645  990 tRTKRLLNSIFTGRtRL--GSNYTNEs-RGILGMYQIPFTAYGQINQIL-ISFAILILILIVYILIRYKWTYYVALALAL 1065 Mesoplasma fl...
WP_047791328  736 -----FARELLSSIaGY-----YGLTpeDPVFNLEKTSPVMETYILKTAgISLAIGIACIFVYTLFRLDWAQFIGILCAA 805  Spiroplasma e...
WP_071937279  753 -----FERDLLSSIaSF-----YGASpsDASLSLQQTDPVMEGYILKIAaISLAIALACIFVYTLFRLDWGQFVGMVLAA 822  Spiroplasma c...
WP_027875315 1071 VVVIAITTSLIIMFRVPISSEILVTMVSIVAFTIMSAIFILGKTKQMISAKTKNELRFEFNKEADAQTVIKHKVLKAVGN 1150 Mesoplasma ch...
WP_041618275 1014 IVAPLVTVAILTTMQVPLGNVAIIGIVSSIIFTIISLFMIFGKARSLIASKNEVSLVNYFKKEIEIIYDTKSFKNQMNDE 1093 Spiroplasma d...
WP_069116211  994 LLAPVLTVGVIVGLYLPVGMSSLIAVAAVIVFSCFTMFIVFGKSRSLIANKDEKSMYNYFKQEIEFLVNIKNARRDLKNE 1073 Spiroplasma h...
WP_026389768 1037 VFITAITVASVIIFRVPVTAEIIAAVVGVMSFAVITAILILGKGKSIISSKTDERINEYFNKEIELAVEIKEYKNTINDI 1116 Acholeplasma ...
WP_104207635 1054 IIIAAITASLIIVFRVPISYELLSTFIGVISFALLSIILMLGKIRSSISSKTKDQLASSFASEIDLKTKFNKSNAELKNK 1133 Mesoplasma co...
WP_023025645 1066 VVVVLITTSLVIMFRVPISTEILVTMISIAAFTIMSVIFILGKTKSLISIKNKNELRFEFDKEANAQAVIKHKVLEAINN 1145 Mesoplasma fl...
WP_047791328  806 VFTLAVSVSIVVIAHILLTFEMSIAFIAIFGFAWAMGAIVMARAKQNKKLVNIKEYETFFTYMSEHRAQVRRLRR----- 880  Spiroplasma e...
WP_071937279  823 IFTLVVTIAIAIITQLLITFEMSIAFLTIFGFAIAFETMVMVRAKQNKKTINIREYETFFAYMSEHRAQIKRLRR----- 897  Spiroplasma c...
WP_027875315 1151 KKALNKKYKDKIRKlkvriidlklakk-srfyywdafkaffKSNRVVEITELKKEIKELRKTRKLELKPLKqeiksvkKA 1229 Mesoplasma ch...
WP_041618275 1094 LFKLKNEMRLEIKT---------------------------NKLSKEEKKKLKLEFKEIKHNKKIDFKKVK-------KD 1139 Spiroplasma d...
WP_069116211 1074 LFMKKSEIKIKIKE---------------------------QDLEKPQKKELYAEYKKFKQQKVLEFKNVK-------KA 1119 Spiroplasma h...
WP_026389768 1117 ISSERNQYANKINDlkvklkdi------------ddkksddYKKVKVEMKSLRNEFRIFRKVEKQKFKDFK-------AK 1177 Acholeplasma ...
WP_104207635 1134 ILNIKKTYELSKNDltkeminaklnkvskfkfinkfkslfiIQSKNPEVKILKAKIKMLKKQLKLDIKPISkeielskQE 1213 Mesoplasma co...
WP_023025645 1146 KKALDRANKKRIKDirrkivdikiakk-skfytwdafkaifKSNRIPKIAELRKEIKAISKENKTDLKPLRksikaakKA 1224 Mesoplasma fl...
WP_047791328  881 --AKKVYMQEEIKKl-------------------------mIANPNLKQKEVKKEFAEHLKTQWKIAKDLAaknkkeiKL 933  Spiroplasma e...
WP_071937279  898 --AHKVYYQEELKKl-------------------------aIKNPDLKLKALKKQYREQLHRVQLAAKDIKsknhkiiRE 950  Spiroplasma c...
WP_027875315 1230 GKKEINSILSENKFVKQLFMNSLKFGLNRLMYISGFYLIFGLILAVTIPSIVGVGIALLIGVVVADIVLLTMSLPLLIWL 1309 Mesoplasma ch...
WP_041618275 1140 NKIKINRVSKQNNYLSEVLVKTFKFGFIRCWLLIGLYSLLGILLVLSMPTIMAFGVSIIIGVIVACLFVLFISVPLWVLF 1219 Spiroplasma d...
WP_069116211 1120 NKIEINRVSKKNNYLKEVMVQTFKYGMKRSILVGFLYVIVSLLLSMSLVPLAGFGISIVIGVVSSIFITLFLALPVWVIF 1199 Spiroplasma h...
WP_026389768 1178 NKKAIKLESKTNNFAKEVFLNVTKFAITKTVFISSIYAIVAIVMALTLPSIVGMGITLVIGIVTTSVVTITIVVPIWIWL 1257 Acholeplasma ...
WP_104207635 1214 NNIEFNKLIKENKYMLEVLNETMKYAIKKVLIIGIIYILFALILAITVPSIVGVGLTLLIGIFTTYIFIISTAVPLTISL 1293 Mesoplasma co...
WP_023025645 1225 GRKEISTILKDNQFAKSLFVDSLRFGINRLVYISGFYLLFAIILAVTIPSLAGVGITLLIGVFVANIVILTMSLPLLIWL 1304 Mesoplasma fl...
WP_047791328  934 INKEFRKYNYTHNFLQKIANLTIKQMLRHCLTLGAIFAIILIILAAFSGSVFGFNITVFIGLAIGMFSVLFLAIPIWVAL 1013 Spiroplasma e...
WP_071937279  951 IRKEFRVYNYEHNFLQKVANVTIKQMLQHCLTLGIMFTILLITLAAFSGTWFGFNVVILIGLIIGMFVTLFVAIPIWVAL 1030 Spiroplasma c...
WP_027875315 1310 EKRRIVLNYGRQEFILQTSVSHEEQIVKDIND 1341 Mesoplasma chauliocola
WP_041618275 1220 EQIRIRNRLARKRFINGLYVSNEEQIIEGIND 1251 Spiroplasma diminutum
WP_069116211 1200 EQTRIRNHLSRKRFINNLKVAHEEQIIEGIND 1231 Spiroplasma helicoides
WP_026389768 1258 ERQRISAKYGYKRFIRKIKVSEEEQIIKDIND 1289 Acholeplasma multilocale
WP_104207635 1294 EKRRIAKKFAYRDFIKTINTSHEEQIVKDIND 1325 Mesoplasma corruscae
WP_023025645 1305 EKRRIVSNYGRKEFISQTNVSQEEQIVKDIND 1336 Mesoplasma florum
WP_047791328 1014 EKYRALNKIRVKNYLDSQRVEIDEQIVAGVND 1045 Spiroplasma eriocheiris
WP_071937279 1031 EKYRALNKIRVKNYLDSQRVEVDEQVVVGIND 1062 Spiroplasma citri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap