Conserved Protein Domain Family
TRAP_S1

?
NF037995: TRAP_S1 
TRAP transporter substrate-binding protein DctP
Proteins of this family are members of the superfamily of Tripartite ATP-independent Periplasmic Transporter (TRAP-T). They transport hydrophobic substrates, usually lipoprotein.
Statistics
?
PSSM-Id: 468304
Aligned: 30 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_016525812  27 KMASVAPARSAWDTEQKALAQEWSRITGGQVELKFYTASALGGEGGVIRKMKALRpgqkspIDGAVFTNIGVYELTPASH 106 Treponema malto...
WP_060835932  28 KASHNANAEEPYGVGMRKMAEILEDRTGGKATIQVFDNAQLGDEMESIQGTQMGT------VGLAVTANDTLANFVPDLA 101 Rhodovulum sulf...
WP_140920686  32 KLAHNLDQEHVVHKALDQMAKEIQEESGGKMRVRIYPNGQMGGPRETIEMMQNGA------LDMTKGSASEMEPFASAFS 105 Insectihabitans...
WP_101253369  28 RAADVQPEDYPTVKALKFMGEDLGKQTNGKYSIKVYHSGQLGSEKDTIEQLKLGA------IDILRINTGALNEVCKATV 101 Telmatospirillu...
WP_029597256  40 KLALVDPENSNFAKGANKIAEEVEKATNGKIKIDVYAGGSLGGERDTIELAMGDN------LDIATAANSVLTNFIPEMG 113 Fusobacterium
WP_055175533  65 QLALVDPETSPYGKGAKKIAEEVEKATNGRIKITVNAGGSLGGERDTVELAMSNN------LDIATAANSVLTNFIPNMN 138 [Clostridium] s...
WP_055459161  31 KIGHLEAATQPRHKGLEKVAALVKERTNGEVEFQLYPASQLGNARQMVEGAQLGS------SEGTVMPAAFLGGFNPVVS 104 Chelatococcus
WP_002570702  54 KVSVGVADNHFEAVAVNKMKEYIEEQTGGNFTVEIFTGAQIGNDQEVFEGLKLGV------ADMLPCGTDIIGNFSKDFG 127 Enterocloster
WP_011750935  24 KIGYALAEDSHYGAGAKAFEASLKESLGDQFSFRHFPSSGLGGEREVLEGLQLGT------VEMTIASDGTLTNFVPEVG 97  Paracoccus deni...
WP_122014054  58 KLGHVANTDQPYHEAAVKFADMVKERTNGAVEIQIYPNSQLGGQRDLLEGLQLGT------VDIVLTSSAVLANFIPKCQ 131 Biomaibacter ac...
WP_016525812 107 ALTLtvPFLF-RNQDELSYVL-D-AMSPEIEKAIKDAGFEFLGWFNVGWANFFTKT-EIRTPDELKKAKMgfSGISSPGL 182 Treponema malto...
WP_060835932 102 VFSL--PFLF-RDADQMDRALsDpAVIAKAQEILNQKGFHLVSFFSAGTRHIMTKT-PIETMDDLAGLKI--RTMQNPAH 175 Rhodovulum sulf...
WP_140920686 106 VFSL--PYLF-KDDAHFKRVL-YgPVGQELMKQTDSKGFVAIAAYVAGTRSFYAKK-PINSPADMKGMKI--RVVSTPTT 178 Insectihabitans...
WP_101253369 102 LPVL--PYVF-KSIDQMHHVV-DgPIGEEILKYCEAQGMVGLAYYDSGARSFYTKK-PIKSLADLKGLKI--RVQQTDLW 174 Telmatospirillu...
WP_029597256 114 ILDQ--PYLW-SNSDEAHAAI-DgAVGDLVKREALKHGLHVIGFMESGYRNTFSTK-PIKTMADFKGVTI--RTMENKYH 186 Fusobacterium
WP_055175533 139 ILDQ--AYLW-TNIDQAHAAV-DgKLGDLIKRDAEKLGLHVIGFMESGFRDTFSTK-PIQSIDDFKGITI--RTMENKYH 211 [Clostridium] s...
WP_055459161 105 VLDI--PFIMpEDRAKSQALR-DgPFGQAILDSFTKRGLVAIAIWPNGRKSVTSAK-PLAGVDSFKGQKF--RVMDSRIL 178 Chelatococcus
WP_002570702 128 LLSL--PYLF-DNEKQVEAVV-EgEFGQSLLKELEDIGYVGLGFGNFGFRHTTNSKhPINSVEDMKGLKI--RTMTTPIH 201 Enterocloster
WP_011750935  98 VLGI--PFLL-RDKDHARKVL-DgEIGQEMLAKFDPAGLHALAWGEQGFRHITSNRgAVEAPADLNGLKI--RTMENPVH 171 Paracoccus deni...
WP_122014054 132 VIDL--PFIF-RDKEHVYKVL-DgPLADKIYEGAENQGMKVISTWENGFRHITNNIrPITKPDDMKGIKI--RVMESQMY 205 Biomaibacter ac...
WP_016525812 183 MAAFKSAGFTMEDVPGEKMLQSIKsTNGIKVAYCIPMYAYATTYYTGLPYIIDVPLNPIMSAFIVSSDTWKAIPDAYKAQ 262 Treponema malto...
WP_060835932 176 VDTFKAFGANPTPLAYTELYGALE-TGVVDGAEAANTNYYAKKFYEVSPDWAVIGWLELVAPVIMGEAAYQALPADVQAA 254 Rhodovulum sulf...
WP_140920686 179 NKIIELLGASPAPIPFGEVYTALQ-QGVIDGAENNEPSYFQTRHVEVAKFYTEDQHTSVPDYLVIASKVWNGMSDEQRAI 257 Insectihabitans...
WP_101253369 175 VAVMKALGVNATPMPYGEVFTGLK-TGLIDGAENNWPSYQSTHHYEVAKYFTLDEHSMAPEVVLISKKVWDSLSPDDQKA 253 Telmatospirillu...
WP_029597256 187 QAAFESFGAMPVAMAYNDVFTALQ-QKTIDAAENATANCLASGYYEVTKFITNTKHAYVYIVLCMSDAAWKKIPEDLQKP 265 Fusobacterium
WP_055175533 212 QAAFKAFGAMPIAMNYNDVFTALQ-QGTIDAAENALCNCWNSGYYEVTKNITKTQHAFVYIVLCMSDKAWQQIPEDLRQP 290 [Clostridium] s...
WP_055459161 179 IQQFAGVGAAAIAIPFGELYTALQ-TGVVDGQENPLDTISTMKYYEVQKDLVVSNHGAMEDLVLFNPAWWNSLPEGHRDV 257 Chelatococcus
WP_002570702 202 LEVFEALGANPTPMAFSELFSALQ-QGVVDGQENPLMNIYANKLHEVQKYLTLDGHVFTFVTFVVSKDWYDKLDPSYQQI 280 Enterocloster
WP_011750935 172 IEAFRALGAAPTPMAWPEVIGALE-QGAIDGQENPLSVIVSAKLNEVQKYLTLDGHVYSSTIILVSPALWNGLDDAQKAA 250 Paracoccus deni...
WP_122014054 206 IEMFKALGANPTPMAMGEVFTALQ-QKTVDAQENPIGQIFASRFYEVQKYLTLDGHTYSPETVVFSLQTWNKLPKEYQDV 284 Biomaibacter ac...
WP_016525812 263 LKQAVRNAQGKFISVQQKSDREYLDKMRAEGCTLVKLSAAEIKLW 307 Treponema maltophilum
WP_060835932 255 LDEAGTEAGRFQRKTYRDSDAARFVDLEAVGVNISHP---DDAAF 296 Rhodovulum sulfidophilum
WP_140920686 258 ITKAARNSEVYQQKLWDEEVTNSRNKAQELGATFITV---DKTPF 299 Insectihabitans xujianqingii
WP_101253369 254 VKQAAKDSVPYMRNLWQAMEVSSRAEVEKAGVTVEQI---DKAQF 295 Telmatospirillum siberiense
WP_029597256 266 FLDAVQRGVEAQRQYLLEANEEATKELKEKGVQFFEIDTEVLKNA 310 Fusobacterium
WP_055175533 291 FLDAVQKGIDAERQYLVEENEAAEKKLIEAGVTIYDIDVEELQKA 335 [Clostridium] symbiosum
WP_055459161 258 IVKAFLEVRPQVETLKEEVQTLAFNQIKEAGVNVRVLGDAERADW 302 Chelatococcus
WP_002570702 281 LNDGIKIATEYMKESCESEDALALEKMKEAGVEVVELTPEAKDEF 325 Enterocloster
WP_011750935 251 FEKAAGDAVTAMRAYVDDVDASGIASMQEAGMQVNELSPEQKAAF 295 Paracoccus denitrificans
WP_122014054 285 IIKAAQEARDFNRQRTAEQNQKFLDQMKSKGLQVTELTPEHKAAF 329 Biomaibacter acetigenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap