Conserved Protein Domain Family
RodA_shape

?
NF037961: RodA_shape 
rod shape-determining protein RodA
Proteins of this family are members of the FtsW/RodA/SpoVE superfamily. It has been reported that RodA proteins play important roles in maintaining cell shape and antibiotic resistance in bacteria.
Statistics
?
PSSM-Id: 411566
Aligned: 44 rows
Threshold Bit Score: 574.539
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_053580881  10 DWTSVILYLLLVMCGWIAIFSTTYSdLNVTSIFDLNQFYGKQLLFIGLSFLLIIFILAIDSRFYINFSVIFYIISIILLA 89  Capnocytophaga ...
WP_028376442  12 DWVIIVLFLALVLIGWLNIYSASVDpTGVAEFFSFDNLFTRQLLFIGLSFLIIIFILSLDAKFFERFASVIYVISIVSLL 91  Leeuwenhoekiell...
WP_094177943  11 DWITVLIYIALVGIGWMNIYSADMT-TNSEYYFDFNQNYGKQLIFIAFTAILVIVILTVDSKFYEKFSSVIFGASLVLLA 89  Flavobacterium ...
WP_105195694  11 DWITVLIYVLLVLIGWANIYSADVT-PDSNYIFDIKQNYGKQLIFISFTILVIIVVLSIEAKFYERFSSVLYGISLLSLI 89  Flavobacterium
WP_134147919  11 DWISVFIYIALVTLGWLNIYSSSLL--------STDGTYQKQLIFIGCTIPLIFVVLFVDGKFYEKYASIIFGVALLSLA 82  Flavobacterium ...
WP_079737389  13 DWLLVLLFVVLVGFGWLNIYSASKS-EEDIQILSFSTKYGKQLIFICLTIPLIVLILFFNSKFYEKFSSILYIISLLSLV 91  Polaribacter sp...
WP_134247530  13 DWVLILFYFMLVLFGWINIYSATIT-EEQFDIINFSTEYGKQLIWIGLSFPIILLILLFDAKFYEKYASLIYLICLISLA 91  Flavobacteriaceae
WP_121966871  11 DWISILLYALLVIAGWINIYSASLP-AETTSIFDLGQIYGRQMLFIIFCIPLIILIVSIDTKFYEKYAMVFYIIGLLSIL 89  Myroides sp. N17-2
WP_140000734  11 DWITILLFITLVIMGWLNIYSASLP-LEQTSIFDISQIYGKQILFICLTVPLVLVVLTVDAKIYEKYAFVFYIIGLVSLL 89  Flavobacterium ...
WP_047790399  13 DWLLVFLYILLVGFGWVNIYAASST-EESREIFDFSTKYGKQLIFIGLSLPVIIFILFFNSKFYEQFSSVMYIFSLVLLA 91  Tenacibaculum
WP_053580881  90 GLFIFGKETNGAKAWYAFGSVTVQPSEFAKVATALAFSRYVSDIHTDIRRTPDLLRAIAIICIPAVLILLQPDVGSLLVF 169 Capnocytophaga ...
WP_028376442  92 GLFVFGKNISGATSWYSFGSFGIQPSEFAKAATALALSKYLSDIQTDVKSFMHQLRAFVIIALPAICIVPQPDPGSALVY 171 Leeuwenhoekiell...
WP_094177943  90 GLFIFGKTIAGQRCWYAIGGLTLQPSEFAKAATALALAKYLSDSQVNLKNIKHQIIALLIMGLPILLILPQPDPGSALIF 169 Flavobacterium ...
WP_105195694  90 GLFIAGKTIAGQRCWYAIGSFTLQPSEFAKSTTALALAKFLSDSQINLKNFNHQLLGLAILFIPIGLIMLQPDAGSALIF 169 Flavobacterium
WP_134147919  83 GLFLFGKTIAGQRCWYAIGSFTLQPSEFAKAATSLALAKYLSDSQINLKDVNRQVQALAIVFLPVMLILPQPDPGSALIY 162 Flavobacterium ...
WP_079737389  92 GLFLFGKTINGATSWYNFGVLGLQPSEFVKAFTALAVAKLLSDRQYNFKLVKNQIKAFAIIFLPAFLIILQPDAGSALIY 171 Polaribacter sp...
WP_134247530  92 GLFIFGKNINGATSWYNFGSFGLQPSEFAKAATALAIAKLVSDKQFNLKKINTQLQAFLILFFPAILITLQPDPGSALVY 171 Flavobacteriaceae
WP_121966871  90 GLFVFGKSVKGQTNWYQIGGFGIQPSEFVKTTTALLLAKFISDSQTHLSTFKEQFIALVIIGVPTLFILKH-DTGSAMLF 168 Myroides sp. N17-2
WP_140000734  90 GLFVFGKTIKGQTNWYSIGGFTLQPSEFVKTSTALLLAKYLSDVQVNLKNFNDQLKAFAIMGVPLLLILLH-DTGTAMIF 168 Flavobacterium ...
WP_047790399  92 GVLVFGKKINGATSWYNFGGIGLQPSEFAKAFTALALAKLMSDRQYNLKLIKNQAKAFIIIFLPAFFIALQPDMGSVLIY 171 Tenacibaculum
WP_053580881 170 FSLAFVLFREGMPSALLFYLFLSGVVFVSSLKFGTTFTL--FACAACIGF-YGFWh--KRKtkRIPFKNIFILSVICLLT 244 Capnocytophaga ...
WP_028376442 172 AAFFFPLYREGLSGVYLIIGSVTIALFVLTLAFGPLWVV--LGIVLIALA-LLFK---NRKk-RFGKRLFYILPIVSILF 244 Leeuwenhoekiell...
WP_094177943 170 IMFIFVLNREGLPSWYLWTGFIAVVLFVMTLVIKPQYVI--LIAFIGIAI-QYLR---SRRi-NRNILASVIILLLISGF 242 Flavobacterium ...
WP_105195694 170 ITMIFVLNREGLPSWYLWTGVGAVVLFIMSLLLKPQYVV--LISLIGVTL-HFYK---SKPv-KRNIVASSIVFLLMTSF 242 Flavobacterium
WP_134147919 163 SIFIVVLYREGLPSWYVWTGFITILLFVLTLVLEPYVVI--LIALAVLMI-IHFK---GRAv-DRNVLLSAILLAIISAF 235 Flavobacterium ...
WP_079737389 172 LSFFFVLHREGLTLYYIIIGVAIVVLFLLTILFGTTIVLssLLGVISVFT-AYILykgGKRffRFNWYKIIGVYLIVTAF 250 Polaribacter sp...
WP_134247530 172 TAFIFVLYREGLPFYYITVGFITLILFVITLYFGFSYTL--LGSFLLFVIiLFYFifyRKRalKKGWVKILGIYFVAAFF 249 Flavobacteriaceae
WP_121966871 169 VSLVFVLYREGLPSWYLWTGFITILLFIASLVVEPGIII--GTIVLIAAL-HFYF---NKKi-TRNPLIYIILVVIMSAL 241 Myroides sp. N17-2
WP_140000734 169 VALIFVLYREGLPAWYLWTGFLAVLLFFMSLLIEPHFVL--LIALVVILV-QFIL---SKRi-NRNPLASSIIFVLIAGF 241 Flavobacterium ...
WP_047790399 172 FAFFFVLNREGLTLAYILFGTISIILFLLTIYFGAKWVL--ISCLLVITLvVFYGiyrNKRffRFNVIKIIGSYLFSIFF 249 Tenacibaculum
WP_053580881 245 AFVTHPVYDNVLKQHHRNRLNLWLRLETDPqkiaamkRDFAYNTNMAESAITSGGTFGKGFLEGTRTKGSFIPEQHTDYI 324 Capnocytophaga ...
WP_028376442 245 VFSVNYIFQNVFEQRHRDRFNVVLGKDVDM-------KSIGYNTYQSEIAIGNGGLTGKGFLKGTQTKGDFVPEQHTDYI 317 Leeuwenhoekiell...
WP_094177943 243 VFSVDYVFENVFKQHHRDRFNILLGKDVDM-------NGIGYNTNQSEIAIGSGGWIGKGFLEGTQTKGNFVPEQHTDYI 315 Flavobacterium ...
WP_105195694 243 SISVNYVFENVFQQHHRDRFNILLGKEVDL-------AGIGYNTNQSEIAIGSGGLLGKGWLEGTQTKGNFVPEQHTDYI 315 Flavobacterium
WP_134147919 236 VLSVDYVFDNVFKQHHRDRFNILLGKSVDM-------KGIGYNTNQSEIAIGSGGWIGKGFLEGTQTKGGFVPEQHTDYI 308 Flavobacterium ...
WP_079737389 251 VLGSGFAYNNVFKQHHRDRFEILLGLKQDN-------QGIGYNSYQSELTISSGGVSGKGFLKGDLTQGDFVPEQHTDYI 323 Polaribacter sp...
WP_134247530 250 IFSVDLVFNHVFEQRHRDRFNILLGKTTDI-------KNIGYNTNQSVTTIASGGLTGRGFLEGERTQGNFVPEQQTDYI 322 Flavobacteriaceae
WP_121966871 242 VFSVDYVYDNVLEPHQKDRINVLIGEDVNL-------QAEGYNLNQSKIAIGSGGWTGTGFLEGTQTKGGFVPEQHTDYI 314 Myroides sp. N17-2
WP_140000734 242 TYSVDFVYDNVLEAHQKDRINVLFGQNVDM-------KNEGYNLNQSMIAIGSGGWFGKGFLEGTQTKGGFVPEQHTDYI 314 Flavobacterium ...
WP_047790399 250 ILGISYTYNNILGQHQKDRFDILLGKIQDN-------KGIGYNSYQSEKTISSGGFSGKGFLQGDRTQGNFVPEQHTDYI 322 Tenacibaculum
WP_053580881 325 FTTVGEEWGFMGTALVVILFSFLLLRLIVLAERQKSKFNRVYGYCVVSILFVHFCINIGMVISLIPTIGIPLPFFSYGGS 404 Capnocytophaga ...
WP_028376442 318 FSTVGEEWGFLGSTLVIALFVGLMLRIIVLAERQKSQFSRIYGYSIAGILFIHFIINIGMVTGVFPTVGIPLPFFSYGGS 397 Leeuwenhoekiell...
WP_094177943 316 FTTVGEEWGFAGSFVLILLFVGLILRILYLAENQKTKFSRVYGYGVASVLFTHFFVNISMVIGIFPTIGVPLPFMSYGGS 395 Flavobacterium ...
WP_105195694 316 FTTVGEEWGFLGSTLVVLLFAGLLLRILYLAENQRTKFSRIYGYGVASVLFTHYFVNIAMVIGIFPTIGVPLPFLSYGGS 395 Flavobacterium
WP_134147919 309 FTTVGEEWGFAGSLVVILLFVGLFLRVIYLAERQKTKFSRVYGYCVAGILFIHFFVNIAMVIGIFPTIGVPLPFFSYGGS 388 Flavobacterium ...
WP_079737389 324 FSVIGEEWGFIGSSLVIILFMLMMYRILYLSETHTNKFGRIYGYSLASILFFHVIVNIGMVIGLLPTVGIPLPFFSYGGS 403 Polaribacter sp...
WP_134247530 323 FTIVGEEWGFLGTTIVILIFTLFLLRIIQIAERQKSKFSRVYGYSIAAIFFTHYTINIGMVLGLLPTIGIPLPFFSYGGS 402 Flavobacteriaceae
WP_121966871 315 FTTVGEEWGFAGASFVIILFVCLFFRLIHLAERQKKVFNRVYGYCVISFLFIHFAFNITMLIGLFPTIGVPLPFFSYGGS 394 Myroides sp. N17-2
WP_140000734 315 FTTVGEEWGFIGAVIVIALFVFLFLRIIYLAENQKTKFSRVYGYCVATFLFAHFFVNITMLIRLFPTIGVPLPFFSYGGS 394 Flavobacterium ...
WP_047790399 323 YSTVGEEWGFLGSSLVIVLFMFLLYRIIYLSETQTNKFARIYGYSVASIFFFHIIVNIGMVIGLLPTVGIPLPFFSYGGS 402 Tenacibaculum
WP_053580881 405 GLWAFTILLFIFLRLDANRLNDW 427 Capnocytophaga sp. oral taxon 323
WP_028376442 398 GLWGFTILLFIFVKLDSDRINQW 420 Leeuwenhoekiella sp. MAR_2009_132
WP_094177943 396 SLWGFTILLFIFIKMDANKVNEW 418 Flavobacterium psychrophilum
WP_105195694 396 SLWAFTILLFIFLKMDANKVNEW 418 Flavobacterium
WP_134147919 389 GLWGFTILLFIFLKMDANKVNEW 411 Flavobacterium sp. 270
WP_079737389 404 SLWGFTILLFIFIRLDAHKKYDW 426 Polaribacter sp. KT 15
WP_134247530 403 ALWGFTILLFLLVRLDANRSYEW 425 Flavobacteriaceae
WP_121966871 395 SLMAFTVLLFIFLKLDANRINEW 417 Myroides sp. N17-2
WP_140000734 395 SLFAFSILLFIFIKMDANKVNEW 417 Flavobacterium microcysteis
WP_047790399 403 SLWGFTLLLFIFIRLDAHKKYDW 425 Tenacibaculum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap