Conserved Protein Domain Family
frad

?
NF037953: frad 
septal junction protein FraD
Proteins of this family are components of cyanobacterial septal junctions (microplasmodesmata) in heterocyst-forming cyanobacteria.
Statistics
?
PSSM-Id: 411559
Aligned: 38 rows
Threshold Bit Score: 476.365
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_095720116  21 IRIILVPPRAYSWQILIYLSVFSWVMSSLSEP-PIKGIISFFGWFFLIAGTSWYTTDQPLLIPGTNMPVGAVITGFLISV 99  Calothrix elsteri
WP_017741707  21 IKKILIPPKAYSWQTLIYLSIFSWFMSSMSTG-FIKDTIAFCGWIFLIFGTAWYTTDSPILVPGTNMPLGAVITGFLVSV 99  Scytonema hofma...
WP_015201026  21 VKKILVPKQAYSWQTLIYLSLFSWLMSSLALG-TARDLIAFCGWVFLIAGTSWYTTDKPILVPGTNLPVGALITGFLVSA 99  Calothrix sp. P...
WP_019489194  21 LKKIFIPPRAYSWQTLIYLSIFSWIMSSLAGY-PIKNVIAFFGWAFLIAGTSWYTTDQPILIPGTNMPVGAVITGFLVSV 99  Calothrix sp. P...
WP_035159401  20 LKKLLLPPKAFSWQTLIYLSLFSWLMSSFTTG-FVKNLIALCGWLFLIAGTAWYTTDKPVMIPGTNMPIGALITGALVSV 98  Calothrix sp. 3...
WP_096685480  21 IKKILIPPRAYSWQTLIYLSLFSWIMSSLAAP-PIKSVIAFFGWAFLIAGTSWYTTDQPILIPGTNMPVGAVITGFLVSV 99  unclassified Ca...
WP_096624854  21 IKFLLIPKKAFSWQVLIYLSLFSWLMSLFSGG-FVRELIALLGWIFLIAGTSWYTTDSAILIPGTNMSVGAVITGFLVST 99  Calothrix sp. N...
WP_015122700  27 VKKFFIPPKAFSWQTLIYLSVFSWLMSYLANG-GIQDIIAFFGWMFLIAGTSWYTTDKPLYIPGTIMPVGAVITGGIVSI 105 Rivularia sp. P...
WP_088243365  22 TQKLLLPSKAYSWQTLIYLSVFSWIMSSWATTfFVKEIIAYCGWGFLILGTAWYTTDNPVVVPGTSMPVGALITGGLVSL 101 Calothrix rhizo...
WP_096660260  27 IKKFFLPPKAFSWQTLIYLSLFSWVMSSLAYG-GIQDIIAFFGWAFLIAGTSWYTTDKPLYVPGTIMPVGAVITGGIVSI 105 Calothrix paras...
WP_095720116 100 F---AFGH-EQDVLTT-----------RTIVLWPSIAAVLTAIPEFFEGSGIDVKRQLPKAEIRQRIIVLLACSLILSCW 164 Calothrix elsteri
WP_017741707 100 F---AFGH-DESVLTT-----------RTIVLWPTISAIITAIPEFFEGTGTEAKTLIPKIEDRQKIIILIGSCAVISCW 164 Scytonema hofma...
WP_015201026 100 F---AVRS--ENVFTP-----------RTLVLWPTISAIITAIPEFFEGSGIDYKRQLPKLEIRQRIIILLAVCMVISCW 163 Calothrix sp. P...
WP_019489194 100 F---AFGH-EEDIITT-----------RTIVLWPTISALITAVPEFFEGSGIDSKRQIPKAEVRQRIIVLVGCCLILSAW 164 Calothrix sp. P...
WP_035159401  99 F---AFGHgEQTTATTakdfvtlplreTTFVLWPTISALITAIPEFFEGSGTDVKQKIPKVEVRQKVLVLVACSMVLSCW 175 Calothrix sp. 3...
WP_096685480 100 F---AFGQ-EEDVITP-----------RTIVLWPTIAAIITAIPEFFEGSGIDSKRQIPKAEVRQRIIVLVGSCLILSAW 164 unclassified Ca...
WP_096624854 100 FfasSLGLaPNEIFAS-----------QQIVLWPTISAIITAIPEFFEGSGTDVKTQLPKIEKREQVVVLLACCMVLSCW 168 Calothrix sp. N...
WP_015122700 106 F---AFQQ-QNEEIVA-----------RTIIFWPTISALITAVPEFFEGSGTDVKTQLPKLEDRESVIVLIGCCMLLSCW 170 Rivularia sp. P...
WP_088243365 102 F---AFRD-GQNLLNP-----------IAFVLWPTMSALITAIPEFFQGTGTNVNAQIPKPEARQKIIVIIASSMLISCW 166 Calothrix rhizo...
WP_096660260 106 F---AF-Q-QDEQLIA-----------RTIIFWPTISALITAVPEFFEGSGTDVKTQLPKLEDRESVITLIGCCMLLSCW 169 Calothrix paras...
WP_095720116 165 LQLYFTVDKWARQYPSIQ-----ADKMVRSTFVIRTEPK-----KDFPENGALILNRLQPRVEEQLNNRVWS-------Q 227 Calothrix elsteri
WP_017741707 165 LQFYFVTENWLNEYPSLQ-----VDNYQGSAFVSRIESA-----ERIPRNGVVILDKLAPQIEQQLNEQPWS-------Q 227 Scytonema hofma...
WP_015201026 164 LQLYFTIDKWARQYPSIL-----ADDFSKSTLIVPTEPK-----LTVPASGAIILNRIQPIVEGQLRGRSWNkqsnndvD 233 Calothrix sp. P...
WP_019489194 165 IQLYFTVDKWARQYPSLL-----FDDFSRSAFVIKTETR-----KQLPENGAKILNRIQPLVQQQLEATPWS-------N 227 Calothrix sp. P...
WP_035159401 176 LQLYFLVNNWLEKYPSLQ-----TDSFQK-TYVLRGGIK-----ESIPRNGVEILEKLQPLIEEEISQQPWS-------E 237 Calothrix sp. 3...
WP_096685480 165 IQLYFTVDKWANQYPSLL-----ADDFSRSPFVIRTGSS-----DKIPENGAIILNRIQPVVQQQIDAKEWS-------D 227 unclassified Ca...
WP_096624854 169 LQLYFVVEGWAKQYPSLL-----ADNFAQSTFVIGTRR------DRIPRKGAEILINLAPVIEERLNGKLWVe------E 231 Calothrix sp. N...
WP_015122700 171 LNLYGVTDSWLNNYPSAKyp-vyRDNSQRNDLLTVLEPE-----NKIPQNGVLILDKLQPAIETALDGKSWS-------N 237 Rivularia sp. P...
WP_088243365 167 LQVYFVLDNWVKQYPSLL-----TDNLNNSVLVKNFSPPedsqiKKIPKNGVVILNKLVPTIITQIDDQPWS-------K 234 Calothrix rhizo...
WP_096660260 170 LNLYGVTDTWLKDYPSAKypiysKEVVKPNDLVTVFEPT-----EKTPINGLLMLNKFQLALETTLNGKSWG-------E 237 Calothrix paras...
WP_095720116 228 VERWLIEAP------LRrdalg-nltgrVNALGNEV--------IQNlskqsgkkvnnvEQQRIEEWQLWNVDAKVS--N 290 Calothrix elsteri
WP_017741707 228 VEQWLINAN------QN-----------VGRLGRQV--------IET------------NLAQYEEKALWVVEPRVT--N 268 Scytonema hofma...
WP_015201026 234 VERWLIEAN------QR-----------VASIGQDI--------MNRyaae----yerkNLVNYEERVFWSTEARVV--N 282 Calothrix sp. P...
WP_019489194 228 VERWLIEAPntknslGR-----------VNALGRQV--------IQDlsrqsgkkvrenQVESLEELRYWNVDARVV--N 286 Calothrix sp. P...
WP_035159401 238 VEQWLLDAK------QR-----------VASLGRNV--------IEV------------NLRKYEEKAFWRTEPRIS--N 278 Calothrix sp. 3...
WP_096685480 228 VERWLKKAPntkenfGT-----------VNAIGRQV--------INDlsrqsgrkvregQVDSVEEWRLWNVDASVD--N 286 unclassified Ca...
WP_096624854 232 VERWLQDNQ------IRqkngqptqpteLENLSERV--------AKQ------------TLKGIEEQKLWKVEPRVR--N 283 Calothrix sp. N...
WP_015122700 238 VELWLKKAN------QR-----------VSDLGEKV--------IQI------------HLAQFEEKEFWKTQASVEniD 280 Rivularia sp. P...
WP_088243365 235 VERILENAR------AKds--------eISKLGRRI--------IEA------------ELGAYKERDLWRVEARVNsiN 280 Calothrix rhizo...
WP_096660260 238 AEKWLKPRNl----tSN-----------VQDLETRVennieqqnIEN------------GLNDFLEQEFWDLKLEVSsiD 290 Calothrix paras...
WP_095720116 291 QKDg--GYKLDLLSIWNGPIS-------NSQGSFLSKSCQIDPISipaNLGTVNIQKPGEKILVSEVKC 350 Calothrix elsteri
WP_017741707 269 LKS---GYKLDLLSIWTGPSS-------TSDRYYLSKTCQIEPVAkigNTRSRVSDKPDEKNTLAEVSC 327 Scytonema hofmannii
WP_015201026 283 TKStnsGYRLDLLSVWKGPSS-------NTKKYFLRKSCQIDPISkpaDNSTVNTRNPGERVIVAEIQC 344 Calothrix sp. PCC 6303
WP_019489194 287 RKGg--GYRLDLLASWDGPRS-------FNKNYYLRKSCQIDPISrpaDASTVNIKKPGERITVAEIQC 346 Calothrix sp. PCC 7103
WP_035159401 279 VKA---GYKLDLLSIWSGPSA-------NPVGYYVRKSCTIDPIA------KSKTGRVEDKGTLAEIEC 331 Calothrix sp. 336/3
WP_096685480 287 VGNnknVYRLNLLALWNGPSS-------SAKRYFLRKSCQIEPISraaDASTVNIKTPGEKITVAEIQC 348 unclassified Calothrix
WP_096624854 284 INN---SYQLDLLNVWQGPQSlgkdetdQDKRFFFKITCQIDPVSq-iSGEGTVNPRPEEKLTVAEVKC 348 Calothrix sp. NIES-3974
WP_015122700 281 PKDynsGYKLNLFSVWTGPSA-------TKKGYYLKRSCQIEPIA----ESVDTVGSQIERITVAELEC 338 Rivularia sp. PCC 7116
WP_088243365 281 TKSp-nVYKLNLLSIWSGPSS-------TKEGYYLQRSCQIEPMA------SSSNTSGREEGARAEIEC 335 Calothrix rhizosoleniae
WP_096660260 291 PKDp-dSYKLDLFTVWKGPSS-------AKNGFYLSKSCQIAPIA----ESIEVIGGRSQKTLFAEMEC 347 Calothrix parasitica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap