Conserved Protein Domain Family
signal_int_SinM

?
NF037948: signal_int_SinM 
signal integration modulator SinM
SinM (signal integration modulator) is a regulatory partner of the hybrid histidine kinase/response regulator SinK (signal integrating kinase).
Statistics
?
PSSM-Id: 468285
Aligned: 5 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_141323847   1 MRLALLSVLLLGVAC-SSDKPPVQGEPDASGPVDSGSdagsdagsdddggtgaddggstGDGGTGSPDAGSGEEDAGsCE 79  Myxococcus sp. ...
WP_120209749   1 MRFALLSALLLCGACsNSKPPPEGEGPDASVPRDAGT----------------------DDGGSTKVDGGPDNPDAG-CV 57  Citreicoccus in...
WP_002639461   1 MRLALLSVLLLGVAC-SSDKPPEPGGPDA-GPG--------------------------ADAGSGDDDAGGG--DAG-CA 49  Myxococcus hans...
WP_015350496   1 MRLALLFVLVLGVACsSSNRPPGPGEPDASASEDSGTrddggtpedd--ggtredggptDDGGTPE-DGGTGEEDAGsCE 77  Myxococcus stip...
WP_141645754   1 MRLALLSVLLLGVAC-SSNKPPVQGEPDASGPEDSGSdagtqpdgg----vdpgdggsgDDGGTGA-DAGPGEEDAGsCE 74  Myxococcus llan...
WP_141323847  80 PPASVRESLLVPGLNNPRRLAVDATDIYISESHSLRPSQTEg-nGQILRVPRSGGDVATVAKGFIAPNAIAVNAQFLFVL 158 Myxococcus sp. ...
WP_120209749  58 ATSLVQPTSVAQGLNTPRRLAQDATDLYISETHSLNPTKSD---GVVLRASKAGGAPTVFAQGFSVPDALAVDATYVYVL 134 Citreicoccus in...
WP_002639461  50 PLAAGPGTLLVTGLNTPRRLAADATDLYISESHSLNPQQPQpgpGRVLRLPRGGGEAVPVAAGFRAPDAIAVTSDSLYVL 129 Myxococcus hans...
WP_015350496  78 PPTSVRETLLVPGLNTPRRLAVDATDLYISESHSLRPGQVDg-eGQLLRLPRAGGDVVSVAKGFIAPDAIAVDSKNIYVL 156 Myxococcus stip...
WP_141645754  75 PPPSVRESLLVPGLNNPRRLAVDATDIYISESHSLRPEAPEg-eGQILRLPRAGGGATSVAKGFFAPDAIAVDEKNIYVL 153 Myxococcus llan...
WP_141323847 159 DQTGLWRVDKATGARGTVPIEASVPD---VISSGTDVLLGRLAGRDYVVVATGARRLVRVDATGSASSSLvlYEGPAGTQ 235 Myxococcus sp. ...
WP_120209749 135 DAMGLWRVHKASAQKGDLPIDARLGTtigATLGGTDLLLTTLQGREVIVVATTSRLLVRLDRDGQTRQVL--FDGGAGSQ 212 Citreicoccus in...
WP_002639461 130 DLDGLWRVDKATGARDARPLDATLNN---VTIGGTEILPARFEGRDVLVIATAHRRLVRVDVSGGNRREL--FAGTGNTQ 204 Myxococcus hans...
WP_015350496 157 DQQGLWRVNKATGERGTVPIEASVNN---VITGGTEVLATRLNGRDVVVVATGARRLVRVDTVGATPASVvlFEGEPGTQ 233 Myxococcus stip...
WP_141645754 154 DQIGLWRVDKATGERGTVPIESSLNS---VITGGTDIRIGRLSGKDVLVVATGARRLVRVDTTGATPSSLvlFEGTVDTQ 230 Myxococcus llan...
WP_141323847 236 VRGARIDGTDVWFLVTGNTEP----GLYRVPLDLETPAERVNASISSGTSLEL-----TPSRFLITEGGGGTGRVLALPR 306 Myxococcus sp. ...
WP_120209749 213 VRGARLVGTDVWFLVAAGTNPnaeqGLYRVPLDGSAAATRVDDNIVAGTSLEVspvglTPTHLLITEGGGGSGTLKRWAL 292 Citreicoccus in...
WP_002639461 205 VRGARVLGEQVWFLVGAGENP----GLYSVPLNGGEPARHLDGSITAGTSLEA-----TSTHFLITEGGGGNGRVLRMPR 275 Myxococcus hans...
WP_015350496 234 VRGARVDGLNVWFLVSGGGEP----GLYRAALDESTPPQRVDPSITSGTSLEL-----TPTHFLITEGSGGTGRVLEVSR 304 Myxococcus stip...
WP_141645754 231 VRGARIDGTDVWFLVTGGTEP----GLYRVPLDLDTPAQRVDASITTGTSLEL-----TPTHFLITEGSGGTGRLIKRPR 301 Myxococcus llan...
WP_141323847 307 AGGE-ARVLADGLQGPLFPVELHGAVYFKESVAGDAGFLRRVRGCPANTTDSVGPVGTGPGGLIVDGDTLLFTSQESGTG 385 Myxococcus sp. ...
WP_120209749 293 SGGK-TEVLASGLQGPMFPVEVEGSLYFKESSAGTPDFLRRVHACAPGGSEPVGPSGTGPGGLLVDGSRLYFTSQEAGTG 371 Citreicoccus in...
WP_002639461 276 VGGP-AEVLASGLQGPVFPVELNGTLYFKDVSTGGTDFLRRVNTCTDGAVEPVGPEGVGPGGLLVDGTTLLYTSQESGTG 354 Myxococcus hans...
WP_015350496 305 AGGDqARVLAEGLQGPLFPVELNGAVYFKESVASGSDFLRRVRGCPPGVTDAVGPLGTGPGGLIVDGNTLLYTSQESGTR 384 Myxococcus stip...
WP_141645754 302 AGGE-ARVLAEGLQGPLFPVELNGAVYFKDAVPRSSAFLRRTRGCPPGTSDAVGPEGTGPGGLIADGDTLLFTSQESGTG 380 Myxococcus llan...
WP_141323847 386 GAVGRVP 392 Myxococcus sp. AB025B
WP_120209749 372 GAVGRVP 378 Citreicoccus inhibens
WP_002639461 355 GTVGRIP 361 Myxococcus hansupus
WP_015350496 385 GAVGRVP 391 Myxococcus stipitatus
WP_141645754 381 GAVGRVP 387 Myxococcus llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogochensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap