Conserved Protein Domain Family
terminal_TopJ

?
NF037946: terminal_TopJ 
terminal organelle assembly protein TopJ
Statistics
?
PSSM-Id: 411552
Aligned: 8 rows
Threshold Bit Score: 373.002
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_036459534    1 MAEKRDYYEVLQIDRDADEQQIKRAFRKLAKKYHPDTNKdDENAESLFREINEAYEVLSNPEKKGRYDKHGHDGLDRE-- 78   Mycoplasma im...
WP_011077717    1 MSSKRDYYEVLGVSKDATDDQIKSAFRKKAMQYHPDRNK-EPDAEEKFKEVNQAYEVLSDPDKRANYDRFGHEGVDGQfg 79   Mycoplasma pe...
WP_052663939    1 MSQKKDFYEILGVDREANDQEIKKAFRKLAQKYHPDRNK-EEGAEEKFKEINEAYEVLSDKTKRSNYDKWGHDGIDGR-- 77   Mycoplasma alvi
WP_151029773    8 MAEKRDYYEVLQIDRDAEEQEIKRAFRKLAKKYHPDTNKdDANAESIFREINEAYEVLSNPEKKERYDKYGHDGLDRE-- 85   Mycoplasma ga...
WP_052663393    2 AEEKRDYYEVLELDRECDENDIKKSFRKLAKKYHPDRNS-AKDAAANFAEVNEAYGVLSDPEKRANYDRYGHEGIDGA-- 78   Mycoplasma te...
CDN40507        2 EKKKHDYYEILGVDRDCDSYTIKKAFRKLAKKYHPDRNG-ARDAAERFAEINEAYEVLGNSEKRRDYDRFGHGDEEKS-- 78   Mycoplasma am...
WP_054173776    2 AEAKRDYYEVLGLSRDADDNDIKKAFRKLAKKYHPDRNK-APDAAQIFAEINEANDVLSNPKKRANYDKYGHDGVDNE-- 78   Mycoplasma pn...
P47442          2 AEQKRDYYEVLGITPDADQSEIKKAFRKLAKKYHPDRNN-APDAAKIFAEINEANDVLSNPKKRANYDKYGFDGVDGE-- 78   Mycoplasma ge...
WP_036459534   79 DDLDFDP-NIFNSFFETINAADEFddisfdddwlddddefsrkkkkkkkdkkggfwak---------------------- 135  Mycoplasma im...
WP_011077717   80 GGAGFDPfDIFNQFFGGGRGGGAH-------------------------------------------------------- 103  Mycoplasma pe...
WP_052663939   78 -PEGFDAtDAFSSFFETIKNDSSFfsddfdtdkkkkkkkkkkddldehedeiekfmhe---------------------- 134  Mycoplasma alvi
WP_151029773   86 DDLDFDP-NIFNSFFETINAADEFdditfdgdwldddkpskkkkkktkkggfwaks------------------------ 140  Mycoplasma ga...
WP_052663393   79 PGFGFAAeEVFSSFFDTINESGAFndlgfdedkpkkrksddddseggnrwkqrrekrrkskeepevqpeqeptpvesvee 158  Mycoplasma te...
CDN40507       79 SDFSFASrEVFSSFFDIINESQAFtqsydqwsetkpkkkrkskkrghksre----------------------------- 129  Mycoplasma am...
WP_054173776   79 GGFAFQA-DVFDSFFEEIEKSGAFdnlsesntkkkektktkkkgwfwgkskqe--------------------------- 130  Mycoplasma pn...
P47442         79 PAFNFQA-DVFQSFFEEIAKSGVFnnqtnpeqkekkkryhwfskkpkqeqp----------------------------- 128  Mycoplasma ge...
WP_036459534  136 -skeasktietepeiidvgfgqssasktklfddsLND--------DEVISSSSvgsddeklfddhkepsftsglddeddq 206  Mycoplasma im...
WP_011077717  104 ----------------------------------FEQs------fGGSGFEDI--------------------------- 116  Mycoplasma pe...
WP_052663939  135 qnakkkeekrkakeakkaakrakkglsekqtenaADDf------tFENTSSDEikkdenssfndldfdnpfsdepv---- 204  Mycoplasma alvi
WP_151029773  141 --keasktietepeiidvgasvnqanetrlfddtLDDq------lEESVSTQStddgerlfddnkepsfta--------- 203  Mycoplasma ga...
WP_052663393  159 ptstfadepsvepeltqetseyqadydepnfdsgLTSe------pSQEFADDYdeprfdadlpephfddgldephfdsgl 232  Mycoplasma te...
CDN40507      130 --------ittnndqptksffdslwneepnfaagLDNs------dHSQEENEF--------------------------- 168  Mycoplasma am...
WP_054173776  131 ------estsdtteyadvdagledyppqsdcpddIPDvdarieevDQSAYADDipdvdagmdweqnaevansasei---- 200  Mycoplasma pn...
P47442        129 -------einldhvveqtikkvqqnqnqnkdpdeLRSk------vPGEVTASD--------------------------- 168  Mycoplasma ge...
WP_036459534  207 eekapsftagl-------------------dddqdeqpsftsdldddkkssdeqetqpaqeesedlsWTRFIGNPDYGHY 267  Mycoplasma im...
WP_011077717  117 -------------------------------------------------------------------FSNFFGGGRRGAS 129  Mycoplasma pe...
WP_052663939  205 ---------------------------------------------vnssdfdiandlpnqedepvefWLKYVGDSYYGYY 239  Mycoplasma alvi
WP_151029773  204 --------------------------------------------------gldeevqsepqpeedlsWTRFIGNPDYGHY 233  Mycoplasma ga...
WP_052663393  233 pesskefvddideprfdadlpatdvtdavvddsmtdindqtattdvvtenvlapegsddseeegnefWRQYINNPDYGH- 311  Mycoplasma te...
CDN40507      169 -------------------------------------------------------------------WRQCVGNPDYGYY 181  Mycoplasma am...
WP_054173776  201 --------------------------------------------ipdvdagladefntssaapqasdWEAMIGNPEYGYF 236  Mycoplasma pn...
P47442        169 -------------------------------------------------------------------WEALVGDTRYGYF 181  Mycoplasma ge...
WP_036459534  268 DENNDWIwegyfddddnfvstrgvdddtqeetkdsktqeesndsptsqtkedlstesvdddyvikteessftsdldkqee 347  Mycoplasma im...
WP_011077717  130 SQQREAN------------------------------------------------------------------------- 136  Mycoplasma pe...
WP_052663939  240 DDNNDWQwkgyfdenqkwipevdqtitksnsnldniseviekieqddkkeiepetnlnsefeakeeikvdidiptnktev 319  Mycoplasma alvi
WP_151029773  234 DENNEWIwegyfddddnfistreleqkvepeqiqpqddrseqeeasdskpqddseddyvipdaeiissptlevtapkeve 313  Mycoplasma ga...
WP_052663393  312 TENEEWVwdgyfdenqvwvpnetlsedanqateevqsdqdpstiqeevvedsvesttepvesensddqntsskstgnydl 391  Mycoplasma te...
CDN40507      182 -QGEEWVwngyfdendqwipnqtdpekpimdqnnepqdgwptlpvanssdlfklqenptiseinsfepsihsfendsqsn 260  Mycoplasma am...
WP_054173776  237 DAAGEWNwkgffdeagqwvwleetepssvsndetttdsdavtaattveetdqdswtansapepvdvetpvelqpetepep 316  Mycoplasma pn...
P47442        182 DETGDWSwkgyfdeqgkwvwnepvdsetsevsvepeptpvapeasfeeaqpei--------------------------- 234  Mycoplasma ge...
WP_036459534  348 vtdkqeedktqpteqevakqeeptveqkteqpqpeataqvestsnidlkqllkvmq-----dqptvettsttelsesass 422  Mycoplasma im...
WP_011077717      --------------------------------------------------------------------------------      Mycoplasma pe...
WP_052663939  320 epkpevkeedsl-------------------------------------------------------------------- 331  Mycoplasma alvi
WP_151029773  314 qplqpeqvahveekeaeeesvaqtkaeevsqptqtvetkptsaveststfdlkqllkvmqeqpteealttteltnettsp 393  Mycoplasma ga...
WP_052663393  392 sflfnkskssqstpteeqktntvssidniddy------------------------------------------------ 423  Mycoplasma te...
CDN40507      261 afngnvhneinknteis--------------------------------------------------------------- 277  Mycoplasma am...
WP_054173776  317 iitlssepveapasvvieptpeieettsavemdasvkadvsdeadatnepteqdti----sepeqetdaaaleeinhtta 392  Mycoplasma pn...
P47442            --------------------------------------------------------------------------------      Mycoplasma ge...
WP_036459534  423 iptddqsaeeenveekeeeqiiddafvesnmpeivdfskqaapspagrnsldlsfliknsatatkqtedttkevsetkav 502  Mycoplasma im...
WP_011077717      --------------------------------------------------------------------------------      Mycoplasma pe...
WP_052663939  332 -------------------------vknenkleskeekeevkkdddplptssgisslgnsmfdlsflsknpvdkfndkve 386  Mycoplasma alvi
WP_151029773  394 ttevseleqtqdksedqqeekvekiddafvesnlpeivdfstkssaslgtanlydlsfliknqptqavqptsetisttpv 473  Mycoplasma ga...
WP_052663393  424 -----epsktvdgsfdessdsegqgledggltsedlfrssdtgsehsptqsaednrdrtvsnqnteeldikkdtkknkkg 498  Mycoplasma te...
CDN40507      278 --------------------qdedliikqqskdllvhieprsddhvsnklfdqlveneetknssatsniqleevvisnln 337  Mycoplasma am...
WP_054173776  393 dlepaevsatndleqdvvekvnfsepestvdtaatdpvveqatetstngfkffnfssfvlsdqnpnpqtpthheedaaap 472  Mycoplasma pn...
P47442        235 ----------------------------------------------------------------naepeasfestptpep 250  Mycoplasma ge...
WP_036459534  503 epteklntkeveqfqeelkevaeelvkddLIDESSMITPPSVIKTKEIefnsestkhvsapqikteevkqdinqptnevv 582  Mycoplasma im...
WP_011077717  137 -----------------------------LVVSIVLTFVESVVGVKKT-------------------------------- 155  Mycoplasma pe...
WP_052663939  387 ndldkklvinenntndypkndtnenvtkeVLLNQPENESSEILKESNNksdevkfepsi--------------------- 445  Mycoplasma alvi
WP_151029773  474 eptdqlkpkevdqiqeelkraaeelvednLIDDSSMITPPSVIKTKEIeveelptkkn---------------------- 531  Mycoplasma ga...
WP_052663393  499 qktekietknkpesseteelaplfidssdAIKDKNVDKTEE-ISTKNLkkqlqdnsd----------------------- 554  Mycoplasma te...
CDN40507      338 dlnntsitnndvdmnheepisevtvdqssQKTSKEIVT----IPVEQPlseqqdnn------------------------ 389  Mycoplasma am...
WP_054173776  473 eptvdetsgestapevtiaestveletaaEINNPATFVEEYLQPTKTTvvdkl--------------------------- 525  Mycoplasma pn...
P47442        251 vapeasfeeaqpeptpipepiptpvqvqpLLLDLNLFT----IPTKATkddl---------------------------- 298  Mycoplasma ge...
WP_036459534  583 dqstkkadivqinldqLEelkfelvqvnqeklppksnedwaqeyklceptqtdkdwykqedandleqliqnqatleiaeq 662  Mycoplasma im...
WP_011077717  156 ----------------IE-------------------------------------------------------------- 157  Mycoplasma pe...
WP_052663939  446 ------ieeefnndfiVNvd------------------------------------------------------------ 459  Mycoplasma alvi
WP_151029773  532 -------dlveinfddLEelkfelvqtnqeklpekavenwaqdyqldeptqsnidwykqedpkdleqlvqdqatleitee 604  Mycoplasma ga...
WP_052663393  555 -------ttvvedfrnVWrnqkpinys----------------------------------------------------- 574  Mycoplasma te...
CDN40507      390 --------pinfvldkLNn------------------------------------------------------------- 400  Mycoplasma am...
WP_054173776  526 -----------deptvAKptvsdsensvapepefvagpeqtfswkpaiseteeipltav--------------------- 573  Mycoplasma pn...
P47442        299 ------------lfdnINlt------------------------------------------------------------ 306  Mycoplasma ge...
WP_036459534  663 essqqdkfsstqeenkiqeekdanvkedsskdqkdqeenqviqaiqeeesliqtesktklqeqqvlqtkkeaefrelfce 742  Mycoplasma im...
WP_011077717      --------------------------------------------------------------------------------      Mycoplasma pe...
WP_052663939      --------------------------------------------------------------------------------      Mycoplasma alvi
WP_151029773  605 nqis---------------------------erkveeqpsvqpakveeeihlepakveeqvvqaikeeeelleqkkaaef 657  Mycoplasma ga...
WP_052663393      --------------------------------------------------------------------------------      Mycoplasma te...
CDN40507          --------------------------------------------------------------------------------      Mycoplasma am...
WP_054173776  574 -------------------------------------------------------epasetqtliaedvtspvtptatai 598  Mycoplasma pn...
P47442            --------------------------------------------------------------------------------      Mycoplasma ge...
WP_036459534  743 qpsqeksttkdhddgaYLSIEELLSQEQEKTtqindiiiennhdnisiaddqnyELTDDNKEFINISQPTIVSsnlnfde 822  Mycoplasma im...
WP_011077717  158 ----------------YKIEKDCESCHGSGA-----------------------DNSEGSISTCSNCNGSGVE------- 191  Mycoplasma pe...
WP_052663939  460 ---------------tYKKENDLSNNETSLV-----------------------AKILNNYSTTIINEKQVLSknendde 501  Mycoplasma alvi
WP_151029773  658 aelfgeqtpttkedddYLSIEELLNSEQTQPaefneiiiennldnvsvaddqnyQLKDDNKEFINISEPTIVSsnlsfeq 737  Mycoplasma ga...
WP_052663393  575 --------ttriieddFQNIDIKSKNDTNSSs---------------------dENQIGVNNKISESKTTVITknldedn 625  Mycoplasma te...
CDN40507      401 ----------------YQTNLPDFNNSEANTl----------------------HQKDENSNEINHNN-IDLAnnneltt 441  Mycoplasma am...
WP_054173776  599 papsinavptapvaetFEAAVDFLKEAAKIEaq--------------------lPLVPTVPEQIDGTDPSLLTqwdeyle 658  Mycoplasma pn...
P47442        307 ---------------tYEQVVDYLNSQATPNl----------------------AKTDGELQTIDGTNPLLLEqckkikk 349  Mycoplasma ge...
WP_036459534  823 qlvnqiegddlikqpdhnkeqyetfdydplqqpvrpmhtsnaemydfrikllrkqtgakmegndssnnknlakkindlsd 902  Mycoplasma im...
WP_011077717      --------------------------------------------------------------------------------      Mycoplasma pe...
WP_052663939  502 ffvlnesdfd--------------------------------------------------------------------fs 513  Mycoplasma alvi
WP_151029773  738 qlvneiesddlikhqeenqeeyqtvdydplqqpvrpmhtsdse-mcnfsikllrkqvgakmegndssnknlankindltd 816  Mycoplasma ga...
WP_052663393  626 stqkipvvnak------------------------------------------------------------------vsn 639  Mycoplasma te...
CDN40507      442 vitklihenvqpdp------------------------------------------------------------qlepls 461  Mycoplasma am...
WP_054173776  659 ktrklfhk-----------------------------------------------------------------------l 667  Mycoplasma pn...
P47442        350 qaeqlfkk-----------------------------------------------------------------------l 358  Mycoplasma ge...
WP_036459534  903 fksrllkrlsetepVNQPTGTkyqepnliqierlteINVVKEVEVHQVLlfNNAIKRIKYTRHtpcnncsatgidltssq 982  Mycoplasma im...
WP_011077717  192 --------------ITQKRTI---------------MGIIQSQNICSRC--NGEGKEIHKKCN----------------- 223  Mycoplasma pe...
WP_052663939  514 sidlettsiiknslSEKPISLlqip-------kreeLNIEYRIQIDQILlfNGISKQIKYYRKipcnlcdgngndinean 586  Mycoplasma alvi
WP_151029773  817 fksrllkrlsetdpSSQPPTSkyqepnliqierlteINVVKEVEVHQVLlfNNAIKRIKYTRHtpcnncsatgidltssq 896  Mycoplasma ga...
WP_052663393  640 sktseldristeeiPENYVLQisq---------qqdLDIIYQARIPQILlfNNSTRRLSYLRNipcevcdatgadisdpn 710  Mycoplasma te...
CDN40507      462 envseslmqtltevVDDMIANrlpddqvlqitkkrnLDISYEVKIPQILlfNNATRRLKYYRCipcktchstgadqndpn 541  Mycoplasma am...
WP_054173776  668 flteqlpfivktdqFEIVDPNlde----------hnVNLIYTEHVPQICflNEQLKEIRYTRKl---------------- 721  Mycoplasma pn...
P47442        359 flkkqlpfitqpevVEESKTSfde----------nnVNLVYFEKVPEILfiNQQPKEVKYTRQv---------------- 412  Mycoplasma ge...
WP_036459534  983 pyklcpacrnvegnvescmvcnqygkliriackNCLGKSYTNEAITLDIKLPITSQLNISVNYPGFGHIFPNNLkGDLTV 1062 Mycoplasma im...
WP_011077717  224 ---------------------------------SCKGRKVHEERVEIDVEIPGGVSNDEHLKVSGKGSVVGGKT-GDLYI 269  Mycoplasma pe...
WP_052663939  587 sifecftcnkspflmnncttcngfgkliaktckQCKGKTYCKELMSLDLRLPVTDKEIYENLYPGFGHVHNSLIkGDLRI 666  Mycoplasma alvi
WP_151029773  897 pyklcpacrnvegnvescmvcnqygkliripckNCLGKSYTNEAITLDIKLPITSQLNISVNYPGFGHIFPNNLkGDLTV 976  Mycoplasma ga...
WP_052663393  711 alricftchnkkaqvencmtcngygrlinkpciKCKGKSYLKEQIILDINLPITDKLKLKVNYPGFGHIIDDKTkGNLIV 790  Mycoplasma te...
CDN40507      542 aflecfscnnkeamgapcltckgygklirvpckKCKGKSYVKEQIVLDINLPITDRLKLKVNYPGFGHIVDEWNqGDLTI 621  Mycoplasma am...
WP_054173776  722 --------------------------------vDPQTQVTTTESITLEVQLSHKSQTEAIAIFKGFGHDYGSGC-GDLKV 768  Mycoplasma pn...
P47442        413 --------------------------------fDGLTNKTTSETITLEIQLLQTPKETVSAIFKGFGNDHGKGC-GDLKI 459  Mycoplasma ge...
WP_036459534 1063 VFKVIPSNFFVIKNNDIHVKALVDPMLASIGGIIKVPTINKLINVRIPPGTKVGDQVIIKDMGLDArydleTKTHYDKGS 1142 Mycoplasma im...
WP_011077717  270 NIQIKPSKIFSRKGNDIYVILKVDPILAIVGGEANIPTPFGIKSIKMKPGTRNGEIITVPSHGVKS-----TKRFGSNGD 344  Mycoplasma pe...
WP_052663939  667 VYEVVKSKFFKPRDNDIVTVVMVDPLVAADGGFILIPTLNDICKLKIKRGLMNNDVIIISGYGLPEhididTNKKVDQGD 746  Mycoplasma alvi
WP_151029773  977 VFKVIPSNFFVIKNNDIHVKALVDPILASIGGIIKVPTINKLINVRIPPGTKVGDQVIIKDMGLDArydleTKTHYDKGS 1056 Mycoplasma ga...
WP_052663393  791 NFIVSKSKLFKLDKNNIWTMTLINNSISTKGGEVFVPTLKQLIKVKLDPGTKVNDQLIIKEQGLPArydvvSKTKYKQGD 870  Mycoplasma te...
CDN40507      622 NFTVIKSKLFKLDKNNVWTMALINHKITRLGGEILIPTLKQLIRVKLDPGTKPNDQLIIEGQGFPPrydvvTKQFMPQGN 701  Mycoplasma am...
WP_054173776  769 VLKVIPSVFFQLQADGLHTAALVDPLVAYNGGLIDVFGPVNSFKVDIEGGIANNDLIEFNQLGV-------LRTKTKRGS 841  Mycoplasma pn...
P47442        460 VFEKIKSPFFQVNEDGLHSACIIDPLVAYNGGIIDVFGPYTNFQVKVDGEIDINAIMKFEKLGI-------AKTK-RKGD 531  Mycoplasma ge...
WP_036459534 1143 LIIQVVYADI 1152 Mycoplasma imitans
WP_011077717  345 LFAVVEYTSA 354  Mycoplasma penetrans
WP_052663939  747 LIIKIRYANV 756  Mycoplasma alvi
WP_151029773 1057 LIIQVVYADI 1066 Mycoplasma gallisepticum
WP_052663393  871 LIIRVIEPKL 880  Mycoplasma testudinis
CDN40507      702 LIVRVIEPKH 711  Mycoplasma amphoriforme A39
WP_054173776  842 LYVHLYYSSV 851  Mycoplasma pneumoniae
P47442        532 LFVHLYYSSV 541  Mycoplasma genitalium G37
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap