Conserved Protein Domain Family
rSAM_RumMC

?
NF035951: rSAM_RumMC 
RumMC family radical SAM sactipeptide maturase
The RumMC family of radical SAM/SPASM domain peptide modification enzymes creates sulfur-to-alpha-carbon (sactipeptide) linages in RiPP peptide natural products in the family of ruminococcin C.
Statistics
?
PSSM-Id: 411536
Aligned: 5 rows
Threshold Bit Score: 864.483
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBY83819       5 LKKIKETIDVERGYSLGTVFTTRNKQYMYDTGTGKVFECGVNEYRILKSLFEQTSLP--DKVDGVSEEeLEAAYRNIWEM 82 
WP_016214181   8 ISKFHKLVPDENYGRLGTTFETESRKYFFDTGTGKVFECDEDEYKVLSYLFKYNKLAseTDLDDLGKS-VFEVYEGILEL 86  Eubacterium sp....
WP_120195531  10 VKRVQGLVPDSNYARLGTTFETINNKYFFDTGTGKVFQCGEVEYKILKFMVEYNTLYfgNESEESESE-VCDTYDQIFDI 88  Lacrimispora al...
WP_016283200  13 EKKFLEMVPDRKFGRLGTVFKTTNNKYFYDAGTGKVFCCEEDEYDVLKYLLDNEDVFpkNTDDMHKIErWCDIYEKLLFL 92  Lachnospiraceae...
WP_055153766   4 MKRLYNAIPVKNYKSLGTVFETTSGLYVYDTGTGKVFSCNEVTYNLFKIIFSGGDTN--EIYEKYSAQeINKSISEIIEM 81  Blautia wexlerae
CBY83819      83 VEAEHILQVSPNLKFVRETDETLRDLLRYDLQQVILELTEQCNMRCRYCIYNEHNEGYRNFSPKAMTWDVAKRAVEYARD 162
WP_016214181  87 SEKEHILQAPKYKEFVQVSDERLKNLVGQNLQQVILELTEKCNLRCKYCVYHEYNPAYRNFETRDMEWDTAKRAIDYTCS 166 Eubacterium sp....
WP_120195531  89 IKNQHILQAPLYKKFTKLSDESLTILLDQELQQVILELTEQCNLRCKYCIYNEYNPEYRNFESRDMDWDTAKRAIEYTCI 168 Lacrimispora al...
WP_016283200  93 CEKENILQAP-LREFYKLEDKDLEVLIDKDLQQIILELTQKCNLRCKYCIYNEYNPAYRDFTNQDMDWDVAKRAIDYARE 171 Lachnospiraceae...
WP_055153766  82 IQKENILQAS-YSEFDRETDFELEAIYNYSLQSLILEVTQKCNFRCKYCIYHSFNEYYRNYGLQDMNWETAKKAIDYVSR 160 Blautia wexlerae
CBY83819     163 NSGDK-VAISFYGGEPLVQFELMKKTIDYSRQIIKGKELTFSFSTNLTLVTPEIAAYVAGVEGMSVLASIDGPEGIHDAY 241
WP_016214181 167 HSGEK-VAVTFYGGEPLVKFELMKKCIEYSRSIMGDRELSFSFSTNLTLMTREIAKYIASVDGCSVLCSLDGPKVIHDSY 245 Eubacterium sp....
WP_120195531 169 HSGKK-VAVTFYGGEPLVKFELMKKCIEYSQDIMGDKELSFSFSTNLTLMNPDIAAYIASVKNCSVLCSLDGPQVIHDSY 247 Lacrimispora al...
WP_016283200 172 HSGKK-IAVTFYGGEPLVRFDLLKKCIDYCLETIKDKELTFSLSTNLTLMTPQIAEYIASIKGCSVLCSIDGPDFIHDAY 250 Lachnospiraceae...
WP_055153766 161 HSGEKeLSIAFYGGEPLINYDVMKKTIEYSEMVMPKKTLIFAFTTNLSLMTLEKAKFFAKHN-CYIMCSLDGPKIIHDAY 239 Blautia wexlerae
CBY83819     242 RVMSGGKGSFEKAIQGLKYLVEAFGERAKESIVINTVVCPPFSAKKLDAIKEFFEGLSWLPKEMVKKCDYVEYGSVREED 321
WP_016214181 246 RVKVDGTGSFEQAIRGLRYLVEEMGEAAKERIIINTVVCPPYSKEKLDMIQKFFDDLDWLPKELDKKCDYVEGGTLRDED 325 Eubacterium sp....
WP_120195531 248 RIKGDGTGTFEQVMRGLRYLVEAMGDSAKNRIIINTVVCPPYSKEKLDMIQDFFDNLEWLPKELDKKCDFVEGGTLRDED 327 Lacrimispora al...
WP_016283200 251 RVSADKKGTHKKAIQGLRYLVEAMGEKGSKRIIINTVVCPPYSKAKLDMIQDFFDSLEWLPSEVTKKCDYVEGGSLRDED 330 Lachnospiraceae...
WP_055153766 240 RVDIKGDGTFNKVIEGLKNLLIAFGDRAKTHIKFNVVICPPYSRKKLDAIKEFFDKLDYLPAGIDIKYSYVESGSLRKED 319 Blautia wexlerae
CBY83819     322 ISMEYAGdGEFIGEELDGFTLDAIEGWALARDLEEEDPKSYVAGIVADKLVRIHNRRQTQEPCKDLRRNGCCIPGNRRVY 401
WP_016214181 326 IAVDFLD-KKDITDRYQTRELDSIKSWALDNVLSGSDQKGYAEGLHTSNLVKIHNRTLTDIPQTRLWRNGCCIPGNRRIY 404 Eubacterium sp....
WP_120195531 328 IAVHFLK-GKNKDEKYQNNKLDSIRSWALDNMLNNSDRKKYSAGINKGNLIKVHNRVLMDKPISRLGRNGCCVPGNRRIY 406 Lacrimispora al...
WP_016283200 331 IDLTFLD-SEEDKEDYKKGEIDSIRAWALDNVLEKNDNRGYSFGVGKDNLIRIHNRILCDKPSKYIHRNGCCIPGNRRIY 409 Lachnospiraceae...
WP_055153766 320 IDYTYFPeGEDIIG-----DVPPIDIWLTEELPKQSSDQNVIFTLARDALARVHKRFLLDHPCEKMKRNGCCIPGGRRIY 394 Blautia wexlerae
CBY83819     402 VKTDGKFLLCEKTGDAPDIGNVFEGADLEKIKKYYIEEYDEKSITRCNECWARNLCGLCYAACYEAEGIDMERKEKVCGA 481
WP_016214181 405 VQVDGNFLVCEKVGNSPSIGNVFTGIDIDRVKKFYLQEYDEQSIDKCSNCWAVNLCGICYATCYCENGLDISVKNNACDY 484 Eubacterium sp....
WP_120195531 407 VQVNGEFLACEKIGDSPSIGNVYTGIDRNSVKKIYLEEYDKKSIEICSNCWAVNMCGICYATCFNKDGLDVNIKNNACEY 486 Lacrimispora al...
WP_016283200 410 VKVNGDFSLCEKVGDCPDIGNVYEGVDIGKVKKYYIEEYENKSIGDCSNCWAVNICGVCYASCCDKNGLNMEYKKVACDY 489 Lachnospiraceae...
WP_055153766 395 VDIKGNIALCERVGKSPSLGNINKGIDLEQVKRYYLEEYEKASVEQCKNCWAVNLCNMCYAACYRENGIDIEAKNELCTY 474 Blautia wexlerae
CBY83819     482 HRYATKGELISYYSILEEKPEVIEEIDAVPYY 513
WP_016214181 485 HREHAKGELMAYYQLLEEKPEVIEKIKDIPII 516 Eubacterium sp. 14-2
WP_120195531 487 QKKQSKGELSAYYQLLEDRPEEIKKIKDIPIV 518 Lacrimispora algidixylanolytica
WP_016283200 490 QKEQAIGELMAYHQLLEDRPEEIEKIKEVPIM 521 Lachnospiraceae bacterium A4
WP_055153766 475 QKDQLKGELIMYHQVLETNPELLEHIQDIEII 506 Blautia wexlerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap