Conserved Protein Domain Family
Zn_serralysin

?
NF035945: Zn_serralysin 
serralysin family metalloprotease
Statistics
?
PSSM-Id: 411534
Aligned: 27 rows
Threshold Bit Score: 681.697
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_006325225  10 SGWDSVNDLLNEHHRGNGLNVN-NKPSFDVGEAGQQIARSEQTWNGVHITGQGATVTYSFPDWDYNqtNLNsvffraddR 88  Serratia plymut...
WP_004161034  10 TGWDSINDLLNYHQRGNGSSVN-NKTSYDIDQAGKEIARGEQSWNGVHVTDKGATVTYSFPSWEPGkkNFN--------G 80  Erwinia amylovora
WP_015377863  10 TGWDSVNDLIHYHERGNGLTIN-NKPSYDINDAGLQIARSDKTWNGVHVTGKDATVTYSFPDWEYNelNLGhrs---seR 85  Serratia marces...
WP_012145115  10 SGWDDVNDLLNYHNRGNGLTLN-NKPSFGVEEAGKQIARSEQTWNGIHVTGKGATVTYSFPDWDYNqsNLNfrfg-snnQ 87  Serratia protea...
WP_017374301  10 TGWDSVNDLLNYHDRGDGLVIN-NKPSFDIEQAGLQIARGDASWNGVGVTGQGATVTYSFPNWTYGdtNIG--------G 80  Enterobacteriac...
WP_010226325  23 SAYSLINSFGHQYDRGGS-ATVnGKPSFSVDQAATQLLRDGAAWKDL-NKDGTINLTYTFLTKAPAg-FDSq-------E 92  Pseudomonas
WP_016781018  23 SAFTQIDNFSHFYDRGD--HLVnGKPSLTTDQAADQLTRSGASWHDL-NGDGVINLTYTFLTAPPVg-YATr-------G 91  Pseudomonas fragi
WP_007910643  10 SAFDEINTFSHLYDRG-V-GLVnGKPSFTADQAADEILRKGLSWGDK-NADGKIDLSYTFLTEKPAn--YNv-------K 77  unclassified Ps...
WP_005788454  17 TAYSQIDSFSHLYDRGGN-LTVnGKPSYTVDQAATQLLRDGAAYRDF-DGNGKIDLTYTFLTSATQstMNKh-------G 87  Pseudomonas
WP_005788146  30 EDYQALYNFSHTYDRGGF-NSSqGKPSYTIAQAADEITRGGYYWGDN-DHNGKYNFTYSFLTSESQa-YASe-------N 99  Pseudomonas syn...
WP_006325225  89 ETGLSAFTAEQQAQAKLSLQSWADVANITFVEVAPG--HKSDITFGNYEG-T-----GQAYAIKPFTqagn-----dysg 155 Serratia plymut...
WP_004161034  81 DTIHSAFNPEQQAQTKLSLQSWSDVANIKFVEVSGD--QYSNITFGNIVApD-----TQAYAMLPQStdngki-iyddrs 152 Erwinia amylovora
WP_015377863  86 DTGLSAFTQHQQEQAKLSLQSWADVANLKFVEVASD--QPSNITFGNYEG-K-----GQAYALKPFSyngn-----dyrg 152 Serratia marces...
WP_012145115  88 DTGLSAFTAEQKAQAKLSLQSWADVANLTFVEVAPD--QKSNITFGNYEG-S-----GQAYAIKPFSgagn-----dyrg 154 Serratia protea...
WP_017374301  81 DFIYSGFSATQQAQARLSLQSWSDVANITFVEVSGD--RYSNITFGNIYApQ-----TQAYALLPQTtnasgrpyyddrg 153 Enterobacteriac...
WP_010226325  93 LGSFSAFSAQQKAQAKLSMQSWADVAKVTFKE--AAtgGDGHMTFGNYSDgss---ggAAFAYLP--------------- 152 Pseudomonas
WP_016781018  92 LGTFSQFSSLQKEQAKLSLESWADVAKVTFTEGPAArgGDGHMTFANFSasn----ggAAFAYLP--------------- 152 Pseudomonas fragi
WP_007910643  78 LGNFSEFSAQQKAQAVLAMQSWADVANVTFTE--GKg-GDGHMTFGNYDvst----ggAAFAYLP--------------- 135 unclassified Ps...
WP_005788454  88 ISGFSQFNAQQKAQAALAMQSWSDVANVTFTE--KAsgGDGHMTFGNYSSgqd---gaAAFAYLP--------------- 147 Pseudomonas
WP_005788146 100 VSGFSAFNAQQRSQAALSFQSWSDVANISFIE--SRsgGDAHISLGNYSNdlqhggaRSAFAFYP--------------- 162 Pseudomonas syn...
WP_006325225 156 QHVAG----QSWYNVNYDVADtgdgvyanlYPDLGNYGRLTFTHEIGHTLGLDHPGDYNAGDG-ATYKSVPTYAEDTRQF 230 Serratia plymut...
WP_004161034 153 FDISG----QSWYSTS-DPENl--------APELGNYGRLTLTHEIGHTLGLNHPGDYNAGEG-NPSYADATYAEDSRQF 218 Erwinia amylovora
WP_015377863 153 YNSDG----QSWYNIKNHSENl--------HPELGNYGRLTITHEVGHTLGLDHPGTYNAGQG-SPNYTKAVYAEDTRQF 219 Serratia marces...
WP_012145115 155 HNTDG----QSWFNINYDYADprdgvyanlHPELGNYGRLSITHELGHTLGLDHPGKYNADENnPPNYSMANYAEDTRQF 230 Serratia protea...
WP_017374301 154 YDASG----QSWYSISGSGv---------lNPELGNYGRLTFTHEIGHTLGLNHPGDYNAGEG-NPTYRDASYAEDTRMF 219 Enterobacteriac...
WP_010226325 153 FDRPGshkgESWYLINSQYQan-------vNPENGNYGRQTLTHEIGHVLGLSHPGDYNAGEg-YPTYADASYGQDTRGY 224 Pseudomonas
WP_016781018 153 SSar---kgESWYLINKDYAvn-------kTPGEGNYGRQTLTHEIGHTLGLSHPGDYNAGNg-NPTYRDAVYGEDTRAY 221 Pseudomonas fragi
WP_007910643 136 SGGSyd--gQSWYLINDQYQvn-------kTPDTNNYGRQTLTHEIGHTLGLSHPGAYNAGNg-NPTYNDAKYAEDTRGY 205 unclassified Ps...
WP_005788454 148 GTGAGyd-gTSWYLTNNSYTpn-------kTPDLNNYGRQTLTHEIGHTLGLAHPGDYNAGNg-NPTYNDATYGQDTRGY 218 Pseudomonas
WP_005788146 163 NNSGn---sDALFYTNQNYQen-------lTPANGNYGRQTLTHEIGHTLGLQHPGSYDASVg-QPSYSDAKYAEDTHAY 231 Pseudomonas syn...
WP_006325225 231 SVMSYWNESYTGGDNGG----HYAAAPLVDDIAAIQYLYGANTSTRAGDSVYGFHSNTGRDFYTANDSSQKLVFSVWDGG 306 Serratia plymut...
WP_004161034 219 SDMSYWNEPNTGGDNGG----NYSAAPLIDDIAAIQHLYGANMTTRTGDTVYGFHSNTDRDFYTAKDSNQKLIFAVWDAG 294 Erwinia amylovora
WP_015377863 220 SVMSYWNESITDADHGH----YYAAAPLVDDIAAIQHLYGANMTTRTGDTVYGFNSNTDRDFYTLKGSHDKLVMSVWDAG 295 Serratia marces...
WP_012145115 231 SVMSYWDESLTGGDNGG----HFAAAPLVDDIAAIQYLYGANTTTRTGDTVYGFNSNTGRDFYTLTDSNQKLVFSVWDAG 306 Serratia protea...
WP_017374301 220 SVMSYWEPSNSGGDFLG----TYAAAPLVDDIAAIQHLYGANLTTRTGDTVYGFNSNTGRDFYTATSASQKMIFSVWDAG 295 Enterobacteriac...
WP_010226325 225 SVMSYWGESNTNQNFTKggvqVYSSAPLMDDIAAIQKLYGANYATRSGDTVYGFNSTADRDFYSATSASSKVVFSVWDGG 304 Pseudomonas
WP_016781018 222 SVMSYWSESNTGQHFTNsgegAYASAPLLDDIAAVQKLYGANLETRSGDTVYGFNSTADRDYYSATSASSKLIFSVWDGG 301 Pseudomonas fragi
WP_007910643 206 SLMSYWSEANTEQNFSKdgsgAYASAPLLDDIVAVQKLYGANYATRADDTTYGFNSNAERDFYSATSASSKVVFSVWDGG 285 unclassified Ps...
WP_005788454 219 SLMSYWSESNTNQNFSKggveAYASGPLIDDIAAIQKLYGANLNTRAGDTTYGFNSNTGRDFLSATSNADKLVFSVWDGG 298 Pseudomonas
WP_005788146 232 SVMSYWSESNTNQNFSKggveAYAAGPLIDDIAAIQKLYGANYSTRAGDTTYGFNSNTGRDFLTATSDADKLVFSVWDGG 311 Pseudomonas syn...
WP_006325225 307 GKDTLDFSGYSQDQRINLTAGSFSDVGGLKGNISIAAGVTIENAIGGSGNDVIVGNNAANIIKGGAGNDVIYGGGGQDQL 386 Serratia plymut...
WP_004161034 295 GNDTLDFSGYSQNQRINLNEGSFSDVGGLKGNISIAAGATIENAIGGAGNDVIVGNAADNVIKGGAGNDVIYGGGGQDQL 374 Erwinia amylovora
WP_015377863 296 GNDTLDFSGYSQNQRINLNEGAFSDVGGLKGNVSIAAGVTIENAIGGSGNDIIVGNHADNTLKGGAGNDVIYGGAGQDQL 375 Serratia marces...
WP_012145115 307 GNDTLDFSGYTQNQRINLTEGSFSDVGGLKGNVSIAVGAVIENAIGGSGNDVIVGNDAANIIHGGAGNDVIYGGGGQDQL 386 Serratia protea...
WP_017374301 296 GNDTLDFSGYSANQRINLNDGTFSDVGGLLGNVSIAEGATIENAIGGAGNDVIVGNEAANVLRGGAGDDVLYGANGSDTL 375 Enterobacteriac...
WP_010226325 305 GNDTLDFSGFTQNQKINLNDASFSDVGGMIGNISIAKGAIVENAIGGSGNDLLIGNAVANELKGGAGNDIIYGGGGGDKL 384 Pseudomonas
WP_016781018 302 GNDTLDFSGFTQNQKINLTAGSFSDVGGMTGNVSIAQGVTVENAIGGSGNDLLIGNDADNVLKGGAGNDILYGGGGADTL 381 Pseudomonas fragi
WP_007910643 286 GNDTLDFSGFNQNQKINLNEGSFSDVGGLVGNVSIAYGVTVENAIGGSGNDLLIGNAVANELIGGAGNDIIYGGGGGDTL 365 unclassified Ps...
WP_005788454 299 GNDTLDFSGFTQNQKINLTATSFSDVGGLVGNVSIAKGVTIENAFGGSGNDLIIGNQVANTIKGGAGNDLIYGGGGADQL 378 Pseudomonas
WP_005788146 312 GKDTLDFSGFTQNQKINLTATSFSDVGGLVGNVSIAKGVTIENAFGGSGNDLIIGNQVANLIKGGAGNDLIYGGGGADQL 391 Pseudomonas syn...
WP_006325225 387 SGGSGKDIFVFAAVSDSPYTSPDKILDFETGIDKIDLSFFNhgdkGNDFIHFVENLSGQAGEALLSYNAQTHLSELALN- 465 Serratia plymut...
WP_004161034 375 WGGSGNDIFVFSDLKDSSSKSPDQIRDFESGKDKIDLSFFNqgdkGSDFIHFVDHFSGQAGEALLSYDARSNLSELAFN- 453 Erwinia amylovora
WP_015377863 376 WGGDGNDIFVFSDLNDSPVQAPDTIWDFESGKDKIDLSFFNqgdkGSDFIQFVDHFSGQAGEALLSYDSQNNLSELAFN- 454 Serratia marces...
WP_012145115 387 FGGSGKDIFVFSAVSDSSFKSPDKILDFETGIDKIDLSFFNhgdnGAGFIHFVDAFSGQAGEALLTYDSQSNLSELALN- 465 Serratia protea...
WP_017374301 376 WGGSGSDIFVFAAVSDAPASAPDKIMDFVSGTDKIDLSFLNp---DGNTLHFVENFSGQTGEAMIAYDAQDNLSELMLD- 451 Enterobacteriac...
WP_010226325 385 WGGAGSDTFIFAASSDSTPSNPDRIMDFVSGQDKIDLSAISafavNKLPLQFVDAFTGHAGEAVLSFDQASNLGSLSIDi 464 Pseudomonas
WP_016781018 382 WGGTGSDVFVFGAVSDSAPGAADIIMDFQSGIDKIDVSAITkl----agLNFVDAFTGRAGEAIVSYDTASNLGHFAVDf 457 Pseudomonas fragi
WP_007910643 366 WGGAGADTFVFGAASDSTMTAPDWIMDFTSGLDKIDLSGIAgfatGAASLNFVSGFTGHAGDAILTYFEQTNQTSLMVDl 445 unclassified Ps...
WP_005788454 379 WGGAGSDTFVYGASSDSKPGAADKIFDFTSGSDKIDLSGITkg----agLSFVNAFTGHAGDAVLSYASGTNLGTLAVDf 454 Pseudomonas
WP_005788146 392 WGGAGNDTFVYGASSDSTPRAADKIFDFTSGSDKIDLSGITkg----agLSFVNAFTGHAGDAVLNYASGTNLGTLAVDf 467 Pseudomonas syn...
WP_006325225 466 -IHGNAGPDFLVHIVGQANAaTDFIV 490 Serratia plymuthica
WP_004161034 454 -VDGGTNPDFMVQIVGQANVaSDFIV 478 Erwinia amylovora
WP_015377863 455 -IQGGANPDFLVHIVGQADVaVDFIV 479 Serratia marcescens
WP_012145115 466 -INGQAAPDFLVNIVGQANTaTDFIV 490 Serratia proteamaculans
WP_017374301 452 -LQGSAVPDFLVQIVGQVNTqTDVIV 476 Enterobacteriaceae bacterium LSJC7
WP_010226325 465 tGNSLS--DFLVTTVGQAVA-TDIVV 487 Pseudomonas
WP_016781018 458 sGHAVA--DFLVNTVGQVAT-YDIVV 480 Pseudomonas fragi
WP_007910643 446 tGQGSV--DFAVGVVGQAVA-TDIVA 468 unclassified Pseudomonas
WP_005788454 455 sGHGVA--DFLVTTVGQAAV-SDIVA 477 Pseudomonas
WP_005788146 468 sGHGVA--DFLVTTVGQAAV-SDIVA 490 Pseudomonas synxantha
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap