Conserved Protein Domain Family
prenyl_rel_EboC

?
NF035940: prenyl_rel_EboC 
UbiA-like protein EboC
Statistics
?
PSSM-Id: 468273
Aligned: 40 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_017748789  12 AYFQLMRPANIVTAWADILAGFAASGsivlanqaviggstPDNLTSLAWLLLSTTGLYGGGVIFNDVFDVSIDSIERPER 91  Scytonema hofma...
WP_004786547   5 AYLTLLRPANVITALADILAGMAIVGfv-------------wkDNSPVFLFLSTVCLYGGGVVLNDYFDAVIDAKERPER 71  Leptospira meyeri
WP_002988268   5 AYITLLRPANVVTALADILAGMAIVGfv-------------wtDNTPVFLLLSTIGLYGGGVVLNDFFDVPIDSKERPER 71  Leptospira vant...
WP_002975474   5 AYLTLLRPANLVTAIADILAGMAIVGfl-------------wnDCSPILLFLSTICLYGGGVVLNDYFDASIDRFERPER 71  Leptospira terp...
WP_012389420   5 QYLILLRPANLVTAIADSLAGMAIVSfp-------------weKEA-MFLLLASVCLYGGGVVLNDFFDEELDSKERPER 70  Leptospira biflexa
WP_015679123   5 PTLQLLRPANLVTAIADILAGMCIVSfq-------------wsGFSYIYLMIASVSLYAGGVVLNDYFDREIDAKERPER 71  Leptospira yana...
WP_010519730   7 AYLQLCRPANLPTAAADVLAGLAISGlfgsla---yfefpNFLNSNLLLLVFASVFLYAGGVVLNDVYDFELDKKERPER 83  Croceivirga rad...
WP_014033743   7 AYLQLCRPPNLPTAAADILAGISISGlfagig---tfaipTVDMFPFLMLILASVFLYAGGVVLNDVFDIAIDKVERPER 83  Muricauda ruest...
WP_019670061   7 GYAKLTRPANLPTAMADIMAGSSISGltflmi--sdtslnGPAYLNLILLIFSSVFLYGGGVVLNDVFDFKIDQIERPER 84  Eudoraea adriatica
WP_018626248   6 HYITLCRPANVITAMADVLAGISIVLfysn------gdgpANFYFKAALLLLTTAALYAGGIVFNDIFDADTDRVERPER 79  Niabella aurant...
WP_017748789  92 PIPSGRVSRTEAILIGSLFLCVGISAALQVSLLSATLASGIAAAALLYDAWGKHHPVFGPFNMGLCRGCNLLLGVSAMSS 171 Scytonema hofma...
WP_004786547  72 PIPTGKVSKRSAFFFGSILLGLGITFSFLYQTQSGWIALFIVFGILTYNRFAKHHSVLGPVVMGICRGGNLILGMSLVTN 151 Leptospira meyeri
WP_002988268  72 PIPSGKVSKLSALIFGSLLLGLGTGFAFLYQIQSGWIAAGIVILILTYNRLAKHHSVFGPIVMGMCRGGNLILGMSLVSE 151 Leptospira vant...
WP_002975474  72 PIPSGKVSEVSVLVFGSFLLGFGLIFAFLFQIQSGFIATAIVILVLTYNRFAKHNSIIGPIVMGMCRGGNLILGMSLVAE 151 Leptospira terp...
WP_012389420  71 PIPSGKVSSLHAFLLGTALLVLGVFFSCLYSEISLVISICIVFLILLYNRFAKHSIIFGPLVMGLCRGFNLILGMTLIKT 150 Leptospira biflexa
WP_015679123  72 PIPSGKVSKEFALLMGTILLLIGVSFSFLYSWNSFLVSLLICFFVILYDCYAKHHFVFGPLVMGVCRGLNLLLGMTSVSQ 151 Leptospira yana...
WP_010519730  84 PIPSGRVAYKNALVFGYALLFIGIICAFLVKLECGVVAMALATAILSYDKVAKHHSFLGPLNMGICRGLNLFMGILYVNQ 163 Croceivirga rad...
WP_014033743  84 PIPSGIVPLGKARSFGFGLLLVGIYFAFLVNSNSGIISIFLAMAILSYNKFAKHHAFFGPLNMGICRGLNLLMGISLLNT 163 Muricauda ruest...
WP_019670061  85 PIPKGEVSLKGAALFGCGLLLSGVFLSFFVNHLSGIIAVILALTILLYDSYSKKYQFLGPLNMGLCRALNLILGMSVFGE 164 Eudoraea adriatica
WP_018626248  80 VIPSGIISKNAALLFGILLFAIALISSAQVNATAFMVTFAIVACALLYDYKSKHHPILGPLNMGACRGLNLLLGISLVPG 159 Niabella aurant...
WP_017748789 172 MIT-ECWLLALIPIVYIAAITTLSRGEVHGGKVSTGIIALLLVSTVIAGLLGLGLLN-NYHLLAALPFVVLLAVRVLLPF 249 Scytonema hofma...
WP_004786547 152 IRSnQLF-LSLFPIVYIAAITMISRDEVNGGKKTNLVVAGVLYIIVIFSQLFLSFFL--GNLYFNFPFVLLHLGMIFPPL 228 Leptospira meyeri
WP_002988268 152 INIsELS-LSLLPILYISAITMISRGEVHGGKKTSLVLAGVFYLTVFLCMSFLSFRL--GNILLNTPFVFLHLGMVFPPL 228 Leptospira vant...
WP_002975474 152 VKTnQLA-LAILPILYIAAITMISRDEVHGGKKTPLVFAGFLYFTVLILQLSISFHM--GNFFFSFPFVILHSGMIFPPL 228 Leptospira terp...
WP_012389420 151 IPSfGMS-LAILPFVYIAAITLISQNEVSGGGKSKFLYAFFLYALVLFSQTFLSYHN--HNVAITIPFILLHSIFLFPPL 227 Leptospira biflexa
WP_015679123 152 IPElGFY-LFILPVIYIAGITLVSQNEVLGGGKSKFIIAIVLFGFVFTVQLFLSYLN--GNLLITSPFVLIHSFLLLPPL 228 Leptospira yana...
WP_010519730 164 LDN---WLYALIPVVFIFAVTLISRGEVHGKNKLNIVFAGLLYTFVIGAVIVLNYFYgLNEGVSYLFFIVLFAFMVFLPL 240 Croceivirga rad...
WP_014033743 164 MEN---WPYVLVPIVFIFAVTMISRGEVHGKNKGNILLAGLLYVAVLSGVFYLHQVY-ANGDLWYLLFLALFAFMVFKPL 239 Muricauda ruest...
WP_019670061 165 IFH---WMYAVIPLLYIFAITLISRGEVYGQNKKHIIWAGLIYAMVIFIVLMIIPDI-RTQWIGLFPIMGLFIFLIYSPL 240 Eudoraea adriatica
WP_018626248 160 VLY-SNIYLGIGPLVYIFAVTTISRDEVHGGKKKNLAIAFILYLLVFMILCIQSSYT---RVYTGLWLLLPFCISILRPL 235 Niabella aurant...
WP_017748789 250 IKAVSKPSPENIRIAVRVGILSLTVLDATVAAGFASLPYGLIVLLLLPISIALSKIFAVT 309 Scytonema hofmannii
WP_004786547 229 IAAYQNPIGPKIGKAVKFGVLSLIVLNASFASCFGFVFIALLVLCLLPVSLLLSKYFSVT 288 Leptospira meyeri
WP_002988268 229 YRAYHNPIGPMIGKAVKMGVITLILLNASFAASFGFFPVALVILCLLPLSLVLAKTFSVT 288 Leptospira vanthielii
WP_002975474 229 YFAFQKPIGPLIGKAVKMGVISLIVLNASFAASFGFIFIAIFILCLLPLSLVLAKYFSVT 288 Leptospira terpstrae
WP_012389420 228 WQAFQNPSPKRIGNAVKMGVITLIILNASFAAAFGMVPLAFLILSLLPISFSISKYFAVT 287 Leptospira biflexa
WP_015679123 229 FKTIQNPIPEHVRKTVKMGVLSLIVLNVSFAACFGMAFVAILIFALLPMSLGLARGFAVT 288 Leptospira yanagawae
WP_010519730 241 IRAYVKNTPQNIKKSVKAGVLSIVLLDAAIAVGFTSIAYGIAILLLLPLSILLAKKFAVT 300 Croceivirga radicis
WP_014033743 240 IKAYQNNTPENIKRAVKSGVLSIIFLDTAMAVAHANLIIGLLMLLLLPLSMYLAKQFAVT 299 Muricauda ruestringensis
WP_019670061 241 IRAYRVNSPDNIKKAVVSGVLSIIVLDASLTVGFDGWQFGLIVLLLLPLSFILAKIFAVT 300 Eudoraea adriatica
WP_018626248 236 YKAWQNPYAKNIIKAVKAGVLSIIFLDATWAAIHHQFLICGIILCLLPISILLGKYFAVT 295 Niabella aurantiaca
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap