Conserved Protein Domain Family
lectin_1

?
NF035929: lectin_1 
lectin
Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
Statistics
?
PSSM-Id: 468266
Aligned: 6 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_137310516  407 RSQAQLEALVDPqvasdtaqsmlddyrqtglfpkwseyngesyvmvgdpaaaivadYYAFGARRFDTAETLQALVAQASK 486  Streptomyces ...
WP_079138696    1 MSRLRESALSAP--------------------------------------------YYAFGATGFDASTALSGLVHQAST 36   Streptomyces ...
WP_145877941  393 RSQAQLEALVAPrvasdtaqsmvddyaqtgifpkwsenngesyvmvgdpadailadYYAFGARDFDATTALADMVKQASR 472  Streptomyces ...
WP_037841047  425 RSQAQLEALVDPqaasdtaqsmvddyaqtgifpkwsedngesyvmvgdpaaaiiadYHAFGATDFDTKAALSDLVKQAST 504  Streptomyces ...
WP_079146807  417 RSQAQLEALVSPeaasdtaqsmtddyaqtgifpkwsenngesyvmvgdpaaaiiadYHAFGARDFDTSKALSGLLKQAST 496  Streptomyces ...
WP_006140138  374 RSQAQLEALVSPevasdtaqsmlddyrqtgvfpkwsenngesyvmvgdpaaailadYHAFGARDFDTSAALAGLVKQAST 453  Streptomyces ...
WP_137310516  487 TNNDRPGLNYLNSPGWMPHDGSYGCCNFYGPVATTLEYDTADFALSALAGALGDGADQKTYAARAQDWRNVLNPASGFVE 566  Streptomyces ...
WP_079138696   37 ATDDRPGLNYLDAPGYMPHDGSYGCCNFYGPAATTLEYATADFAVSALAKALGDSANRTTYLDRAQNWRNVINPASGLVQ 116  Streptomyces ...
WP_145877941  473 ANNDRPGLGYLNSPGYMPHDGSYGCCNFYGPVATTLEYDTADFALSAMAGALGDTANQKTYANRAQDWRNVLNPASGFVE 552  Streptomyces ...
WP_037841047  505 ANNDRPGLNYLNAPGYEPHDGSYGCCNFYGPVATTLEYNTADFALSAFAGALGDTANQHTYANRAQDWRGTLDPSSGFVE 584  Streptomyces ...
WP_079146807  497 TNNDRPGLNYLDTPGYEPHDGSYGCCNFYGPVATTLEYDTADFALSAFAGALGDTRSRQTYAHRAQDWRNVLNPDSGFVQ 576  Streptomyces ...
WP_006140138  454 ANNDRPGLNYLDAPGYLPHNGGYGCCNFYGPVATTLEYATADFALSAFAGALGDTANQRTYADRAQDWRGTLDPASGFVQ 533  Streptomyces ...
WP_137310516  567 PRNANGSWTGGFDPTSGTDMVEGDSWIYTGMIPFNIAGLARAKGGNTAMNHYLDTVLRSFTGDKGYAWVGNEPSIELPWE 646  Streptomyces ...
WP_079138696  117 SRNADGTWVGGFDPTSGDDMVEGDSFIYTGMVPFDLAGLAQAKGGGTAMTHYLDTVLRSFTGDSGYAWVGNEPSIELPWE 196  Streptomyces ...
WP_145877941  553 PRNVSGSWTGGFDPTSGTDMVEADSWIYTGMVPFDIGGLAHAKGGNTAMNHYLDTVLRSYTGANGYAWVGNEPSIELPWE 632  Streptomyces ...
WP_037841047  585 PRDADGTWVNGFDPTSGTDMVEADSWIYTGMVPFDVAGLATAKGGNTAMNHYLDSVLRSYTGADGYAWVGNEPSIELPWE 664  Streptomyces ...
WP_079146807  577 PRNANGSWTSGFSPTSGTDMVEADSWIYSGMVPFNVAGLATAKGGDKAMNDYLDTVLRSYTGANGYAWVGNEPSVELPWE 656  Streptomyces ...
WP_006140138  534 PRNADGTWTAGFDPTGGTDMVEADSWIYTGMVPFDVAGLAAAKGGDAVMSDYLDTVLRSYTGANGYAWVGNEPSIELPWE 613  Streptomyces ...
WP_137310516  647 YDYTGAPYKTQGTVRAIQNQIWSDTPSGLADGNDDLGAMSAWYVWSALGMFPQTPGTADLALGSPVFPQAVITLPSGGTL 726  Streptomyces ...
WP_079138696  197 YDYTGAPYRTQGTVRAIQDQIWRDAPDGLADGNDDLGAMSAWYVWSALGMFPETPGTSDLALGSPMFTQAVVTLPSGGTL 276  Streptomyces ...
WP_145877941  633 YDYTGQPYKTQGTVRAIQDQIWSNTPGGLADGNDDLGAMSAWYVWSALGMFPETPGTSDLALGSPLFTQAVITLPSGRTL 712  Streptomyces ...
WP_037841047  665 YDYTGEPYKTQSTVRSVQDQIWANSPSGLADGNDDLGAMSAWYVWSALGMFPMTPGTSDLALGSPVFTQAVVTLPSGKTL 744  Streptomyces ...
WP_079146807  657 YDYIGEPYKTQATVRSIQDEIWSDTPEGLADGNDDLGEMSAWYVWSALGMYPMTPGTSDLALGSPLFSQAVITLPSGKTL 736  Streptomyces ...
WP_006140138  614 YDYLGEPYKTQGTVRAIQDQIWANTPAGLADGNDDLGAMSAWYVWSALGMFPMTPGTDDLALGSPLFPQAVLTLPSGRTL 693  Streptomyces ...
WP_137310516  727 TVNGTGAADDAPYVQSATWNAAPWNNAYAPATALTSGGTLTYTLGTAPNTGWASAASAAPPSYSGGVPAPATPRVGPVTS 806  Streptomyces ...
WP_079138696  277 TVNGNGAADNAPYVQSATWNGAGWNNAYAPAGAVTSGGTLDFTLGTSADTSWATAASAAPPSYGGDPVAPPSPRTGPITS 356  Streptomyces ...
WP_145877941  713 TVNGSGAADNAPYVQSAVWNGTAWNNAYAPTTAITAGGTLDFTLGTSANTSWATAATAAPPSYAGDTTAPASPRIGPLTS 792  Streptomyces ...
WP_037841047  745 TINGNGAADNAPYVQSATFNGSAWNNAYAPTTAITDGGTLSYTLSTSADTDWAAGSAAAPPSYGGDVAAPPKPRVGAVKS 824  Streptomyces ...
WP_079146807  737 TINGDGAADDAPYVQSATFNGSAWNNAYAPTTAITSGGTLSYTLGTSPNTGWATQASAAPPSYPGDTAAPPKPRVGPVKA 816  Streptomyces ...
WP_006140138  694 TINGEGAAADAPYVQSASFDGAAWNNAYAPTNARSDGGTLTYRLGTTANTSWASAASAAPPSYHGSVLAPPDPRAGIVTS 773  Streptomyces ...
WP_137310516  807 GVTGGsgkLCVDVADSGTGDGTHIQTWGCNQTYAQDVTMASDGTLRVLGKCVDVSNSGTANGTLVQLYRCNGTGAQQWKP 886  Streptomyces ...
WP_079138696  357 AVSAG---LCLDDAGSSTGDGSHVQIYGCDGTAAQDWTIADDGTVRTLGKCLDAASGGTTNGTLVQLWTCNGSGAQQWKA 433  Streptomyces ...
WP_145877941  793 AVAAS---LCADDASSGTSDGTHVQIWGCNNTYAQDWIVAGDGTVRTLGKCLDAAHSGTTNGTLIQLWTCNGTGAQQWTA 869  Streptomyces ...
WP_037841047  825 A--GG---QCVDDANSSTSNGSAIQIWGCDNTAAQDWVIATDGTLRTLGKCLDVSDSGTTSGTKVQLYGCNGSGAQQWKP 899  Streptomyces ...
WP_079146807  817 GVDSA---QCVDDAGSGTADHTAVRLWACNGTYAQDWTVATDGTLRTLGKCLDVTNSGTTDGTLVQLYTCNGTGAQQWTA 893  Streptomyces ...
WP_006140138  774 GVNAG---TCLDVDHSGTADGTAVQIHTCNSTYAQDWTVAGDGTLRALGKCLDVANSGTANGTAVRLWTCNGTGAQAWSP 850  Streptomyces ...
WP_137310516  887 GTAGSLVNPASGKCLDVPNSATSEGTQLQIYTCNGTGAQNWTLP 930  Streptomyces lasalocidi
WP_079138696  434 GAAGSLVNPQSSLCLDDPGSSATERTQLQLYTCNGSAAQNWTTP 477  Streptomyces rubidus
WP_145877941  870 GANGSLVNPESQLCLDDPGSSTTNGTQLQLYTCNGTAAQNWKLP 913  Streptomyces sp. BK340
WP_037841047  900 GANGSLVNPESGLCLDDPSGSTTEGTRLQIYTCNGSGAQNWTLP 943  Streptomyces sp. NRRL F-5126
WP_079146807  894 GADGSLTNPHSGLCLDDPNSSTTQGTRLQIYTCNGTAAQKWTLP 937  Streptomyces griseochromogenes
WP_006140138  851 GSGGTLVNTNSGRCLNDPNASTADGTRLEIRDCAGGTAQKWNLP 894  Streptomyces griseoaurantiacus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap