Conserved Protein Domain Family
TPP_ScyA_rel

?
NF035927: TPP_ScyA_rel 
ScyA-related TPP-binding enzyme
Members of this family are not ScyA itself, which is described in TPP_ScyA (NF035923), but instead are closely related paralogs that are likewise restricted to the Cyanobacteria. Nostoc punctiforme, for example, has ScyA itself, but also has three members of this family, all more closely related to each other than to ScyA. By homology, members of this family are expected to be thiamine pyrophosphate-binding enzymes.
Statistics
?
PSSM-Id: 411516
Aligned: 14 rows
Threshold Bit Score: 1110.96
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015191512  38 TVTQALVELLEEFGVKSAFGVSGGGIGPMWATLEHSLIKVLHFRHEAGAAFAAVESYFATNRPTVVFTTTGPGITNALTG 117 Stanieria cyano...
WP_087545837  62 SVASIVVKMLEDMGVQYAFGVSGGAIAPMWHALQHSSIQVLHFRHEAGAAFAATEAYFASGRPVVVFTTTGPGITNALTG 141 Nostocales cyan...
WP_088242307  36 TVGETVVKMLEEMGVESAFGISGGGIGPLWAALNRSNIQVLHFRHESGAAFAACEASFASDSPVVVFTTTGPGITNALTG 115 Calothrix rhizo...
WP_012408691  36 TVAAALVKTLENLGVRYAFGLFGGGITPFIASLEQSSIEVLQFRHEAGAAFAAIESYFASGHPVVVFSTTGPGITNALTG 115 Nostoc punctiforme
WP_012408718  51 SVASAIVKMLEDLGVEYAFGVSGGAIAPVWYKLQHSSIKLLHFRHEAGAAFAATEAYFASGRPVVVFTTSGPGITNALTG 130 Nostoc punctiforme
WP_017317769  56 TVGEAVVKILEDAGVHCAFGISGGGIGPFWAALNRSNIQLLHFRHESGAAFAATETYFASGRPVVVFTTTGPGITNAITG 135 Mastigocladopsi...
WP_017743047  43 TIGEALVKTLEDMGVRYAFGVSGGGIGPLWATLNRSNIELLHFRHESGAAFAACEAFFASDRPVVVFTTTGPGITNALTG 122 Scytonema hofma...
WP_017747608  68 SVAFAIVKMLENMGVQYAFGVSGGAIVPLWHALQHSSIRVFHFRHEVGAAFAATEAYFVSDRPVVVFTTTGPGITNALTG 147 Scytonema hofma...
WP_038084134  25 SVASVIVKMLEEIGVKYAFGVSGGAIVPLWHALQHSSIRVLHFRHEAGAAFAATEAYFASGSPIVVFATTGPGITNAITG 104 Tolypothrix bou...
WP_038296497  68 SVAEAVVEMLQNMGVVHAFGVSGGGVAPLWTVLERSPIQVFHFRHEAGAAFAATESYLASGRPVVVFTTTGPGLTNALTG 147 Nostocales
WP_015191512 118 LLAARGDGAKVIFLSASTSAVSRGRAACQETSTYNMPSSGLFTSGPLFHYATTVESSEQLPEVALRLALGLAQPEGFVAH 197 Stanieria cyano...
WP_087545837 142 LFAARWEGAKVIFLSPSTSAPQRGRSAFQETSAYTLPGAGIFTSESLFNYATTLECSDELPVVYRRLALGLARPDGFVAH 221 Nostocales cyan...
WP_088242307 116 LLAARGEGAKVILLSAATATGNRGRWACQETSSHTMPISGLFTPGPLFNYATIIETGDEIPEISRRLAQGLSQPGGFVAH 195 Calothrix rhizo...
WP_012408691 116 LFAARWEGAKVIFVSPCTSATQRGRWAFQETSQYTMSNTGIFTSGTLFHYATTVECNSELSEIARRLALGVGKLGGFVAH 195 Nostoc punctiforme
WP_012408718 131 LLAARWEDAKVIFLSASTSAPQRGRWALQETSTYTMPSAGLFTSDSLFHYATTLECSEELPEVYRRLAKGLARPDGFVAH 210 Nostoc punctiforme
WP_017317769 136 LFAARGEGAKVILVSAITPAGNRGRWACQETSAHTMPLSGIFTPGPLFNYATILESADQLPEIARRLAQGLAQPGGFVVH 215 Mastigocladopsi...
WP_017743047 123 LFAARGEGAKVILLSAATPTGNRGRWACQETSAYTMPMSGIFTSGPIFNYATTLESEDELPEISRRLALGLSQPGGFVAH 202 Scytonema hofma...
WP_017747608 148 LFAARWEGAKVIFLSASTSTSQRGRWSLQETSTYTMPSTGIFTKEPLFHYAATLESGDELPQICQRLARGLTQLGGFVAH 227 Scytonema hofma...
WP_038084134 105 LFAARWEGAKVIFVSASTSTSQRGRWACQETSAYTMPTTGIFTSESLFHYATTVESDDELPEIYCRLAKGLAQPGGFVAH 184 Tolypothrix bou...
WP_038296497 148 LFAARSDGAKVILLSGYTPVAQRGRWALQETSSYTMPISGLFTSGSLFHYATILESDAELPEIARRLSIGLGQLGGFVAH 227 Nostocales
WP_015191512 198 VSIPTAIQTSLLNAPLAPVKFSRSLPTAGEDAIAECIRLLSQKPFAIWVGFGARNAATEIKQLAERTGAAVMCSPRAKGI 277 Stanieria cyano...
WP_087545837 222 LNIPTDIQTSLVKTSLPRVNLSVAPTSASEETISECARLLSEEPFAIWVGFDARNAATEIRQLAERTGAAVMCSPRGKGI 301 Nostocales cyan...
WP_088242307 196 ISIPTPIQTTPCTAQ-PQVGFVRGELAPSVNVMAECVQLLSQEPFAIWIGFGARGAAAEIKQLAESTGAGVMCSPRAKGI 274 Calothrix rhizo...
WP_012408691 196 ISIPRTIQTSLLTTPLPHVNFSPTLVTAGEDTISKCLQLLCEAPFAIWVGFGAKDAALEIRQLAERTGAAVMSSARGKGI 275 Nostoc punctiforme
WP_012408718 211 LSIPTNIQTNSVEKSLPPVTLSFAAPTASDEAISECGHLLSEGPFAIWVGFGARFAAAEIRQLAERTGAGVMCSPRGKGI 290 Nostoc punctiforme
WP_017317769 216 ISIPTPVQTTPLKAPLPEPGFSHALPVASEEAIAECVRLLSEESFGIWVGFGARHAAQEILELAEKTGVAVMTSPRGKGI 295 Mastigocladopsi...
WP_017743047 203 ISIPTSLQTMPLKLRLPEQVFSYSVPTASEEAIAECVKLLSQETFAIWAGFGAKNAAREICLLAEKTGAAVMTSPRGKGI 282 Scytonema hofma...
WP_017747608 228 LSIPTNIQTSSVNTSLPQVSLFFASAIATEETISKCADLLSQEPFAIWVGFGARFAAAEIRQLAERTKAMVMCSPRGKGI 307 Scytonema hofma...
WP_038084134 185 LSIPRNIQVSSLKTSLSQVALSLAPPSTTEDAIAKCAGLLSEGSFAIWVGFGAREAASEIRQLAERTGAAVMCSPRGKGI 264 Tolypothrix bou...
WP_038296497 228 ISIPTGIQGSPNKISVPQVAFSRTIATVSNEAIAKCVQLLNEGPFAIWVGFGARYAAQEIRQLAEKTGAAVMCSPRSKGI 307 Nostocales
WP_015191512 278 FPESHPQYLGVTGFSGHETVLNYMESQRPDYILVLGTRLGEPTSFWSPAMLPNQGFIHVDIDPEVPGTAYPTANTFAIHS 357 Stanieria cyano...
WP_087545837 302 FPEDHPQFVGVTGFGGHDSVLRYMQEYRPLRTLVLGTSLGEFTSFWNPAMIPSRGFMHVDIDPKVPGTAYPSVETFAIQS 381 Nostocales cyan...
WP_088242307 275 FPENHPQFVGVTGFSGHTSVLTYMREQKPCRILVLGTRLGEPTSFWDPEMVPAGGFIHVDIDPEVPGVAYPSAPTFSIQS 354 Calothrix rhizo...
WP_012408691 276 FPEDHPQFVGVTGFGGQNSVLKYMQEQRPLRVLVLGTKLGEFTSFWNPVMVPSRGFVHVDIDPEVPGAAYPYAETFSVQS 355 Nostoc punctiforme
WP_012408718 291 FPEDHPQFVGITGFAGHESVLRYMQEHRPLRTLVLGTRLGEFTSFWNPAMIPLRGFLHVDINPDVPGTAYPSSETIAIQS 370 Nostoc punctiforme
WP_017317769 296 FPENHPQYVGVTGFSGHLSVLTYMQEQRPQRLLVLGTRLGEPTSFWSPQMVPADGFVHVDIDPEVPGVAYPSAQTFSIHS 375 Mastigocladopsi...
WP_017743047 283 FPEDHPQYVGVTGFSGHMSVLKYMQEQCPQRILVLGTRLGEPTSFWHPAMVPAGGFIHVDIDSQVPGVAYPLVETLSIQS 362 Scytonema hofma...
WP_017747608 308 FPENHPQFVGVTGFAGHKSVLEYMREYRPVRTLVLGTRLGEFTSFWNPAMIPSQGLVHIDIDPQVPGSAYPFAETFAIQS 387 Scytonema hofma...
WP_038084134 265 FPENHSQFVGVTGFGGHESVLKYMQESCPLRTLVLGTRLGELTSFWHPSMVPDRGFLHVDIDPEVPGTAYPYVETFAIQS 344 Tolypothrix bou...
WP_038296497 308 FPEDHPQFIGVTGFAGHPSVLTYMQVQCPRHVLVLGTRLGEFTSFWRPDMVPSRGFIHVDIDPEVPGTAYPSAETFAIHS 387 Nostocales
WP_015191512 358 EIKVFVKNLLRYFPsTSCKGNSRIAPTTRQSSygqIPFAPTSLVRPEILMDAIQKVIVEGSDAIVMAEAGNSFAWATHHL 437 Stanieria cyano...
WP_087545837 382 DVKMFVKTLLKHFPqRQGRSNILSFPRPKRNV---INPSASSPVRPEVLMNVIQRVIIEGSDAVVMTEAGNSFAWGNHML 458 Nostocales cyan...
WP_088242307 355 EIKIFLKSLLQYFPlSPGQTCSLSLPNPEKQE---TSAHTDGLVRPDFLMDTIQRVIVEGSDAVILAEAGNSFAWATNRL 431 Calothrix rhizo...
WP_012408691 356 DIGAFVRAILKYFPeISRSSSVLPLPRPEREV---IKSHLEGLVRPEFLMDAIQRVIVENSDAIIMTEAGNSFAWGTNIL 432 Nostoc punctiforme
WP_012408718 371 DVKMFVKALLKRFPkRQNRAKKQSLPRPERSV---INASTNSPVRPEVLMNLMQRVIVEGSDAIVMAEGGNSFAWAINLL 447 Nostoc punctiforme
WP_017317769 376 EVKVFLKMLLKHLPeRLNWSPTSMLPRPEGYA---NAPRINGLVRPDVLMNAIQRVIVEGSDAIIMAEAGNSFAWATNLL 452 Mastigocladopsi...
WP_017743047 363 EVKVFLQALLKQFPsSLDFP-VFMFSRPERTV---SPRRPEGLVQPDVLMDAIQKVIVGGSHVIVMAEAGNSFAWATHLL 438 Scytonema hofma...
WP_017747608 388 DVRLFVKELLKHLSeEQNQSKTRSRSQPKRHV---INPRSHSQVRPEVLMNAIQQIIVEGSDAVVMAEGGNSFAWAIHLL 464 Scytonema hofma...
WP_038084134 345 DIRVFVKALLKYFPdNQDES-AIALSQAEPKS---VNTPAKNLVRPKVLMDAIQATIVEKSNAIVMTEAGNSLAWGNHVL 420 Tolypothrix bou...
WP_038296497 388 DVGMFVKALLEDIPkRREGSEVLSLPRPHHEI---INPSPERLVRPEVLMDAIQRVIVEGSDALVMAEGGNSFAWAIHLL 464 Nostocales
WP_015191512 438 KFDQPyRYRISTGVGAMGHAATGVVGAALGWHDKAIAIAGDGAMLMNSEINTAVKYEAPAVWIVLNDARYNMCDQGMNLQ 517 Stanieria cyano...
WP_087545837 459 RFNKSgRYRVSTGFGAMGHAVTGVLGAALARNGKAVAIVGDGAMLMNSEVSTAVQHQIPAVWIVLNDSHYNMCDQGMALL 538 Nostocales cyan...
WP_088242307 432 CFNQPgRYRISTGMGAMGHAVTGVVGASWGGHTKAVAIVGDGAMLMNSEVSTAVRFNIPAVWIVLNDGRYNMCAQGMNLQ 511 Calothrix rhizo...
WP_012408691 433 RFAAPgRYRVSTGFGSMGHAGTGILGAALARNRKAVAILGDGAMLMNNEITTAVKHKIPAVWIVLNDARYNMCDQGMNME 512 Nostoc punctiforme
WP_012408718 448 RFSKPgRFRVSTGFGAMGHFVTSVVGAALTHQGKAIAIVGDGAMLMNNEVSTAVRYQIPAVWIVLNDARYNMCEQGSQMQ 527 Nostoc punctiforme
WP_017317769 453 RFTQPgRYRISTGVGAMGHAVTGVVGASLGRYGKAVAIVGDGAMLMNNEISTAVRFEIPTVWIVLNDGRYNMCAQGMALQ 532 Mastigocladopsi...
WP_017743047 439 RFTEPgRYRISTGVGAMGHAVTGVLGAALGRNSKAVAIVGDGAMLMNSEVSTAVKFQIPCVWIVLNDGRYNMCAQGMALQ 518 Scytonema hofma...
WP_017747608 465 RFTQPgRFRVSTGFSSMGHMTTGVVGAAIAHHGKAVTIVGDGAMLMNNEVSTAVSYQIPAVWIVLNDGRYNMCAQGLNMQ 544 Scytonema hofma...
WP_038084134 421 QFTESgRYRASTSFGSMGHFVTGVVGAALASNKKAVAIVGDGAMLMNSEISTAVRYEIPAVWIILNDGCYNMCRQGVAFE 500 Tolypothrix bou...
WP_038296497 465 KFTQPdRFRISTYFASMGHFVTGVVGGALGHNGKAVAIVGDGAMLMNNEVSTAVKFRIPAVWIVLNDARYNMCDQGNTAQ 544 Nostocales
WP_015191512 518 GLKGIDAHIPPADFVKIAQGMGADGIRVEKESDLEAALAKAMAATIPFVVDVIIDPTFPSPIAGRVKSLMKQGA 591 Stanieria cyanosphaera
WP_087545837 539 GFKGIDAKISQTNFVKIANGMGADGIRVEKESDIQAALEKALVSLSPFVIDVVIDPTRSAPIGSRIHNLISQGV 612 Nostocales cyanobacte...
WP_088242307 512 GFKGVDTQIPSTNFALIAQGMGGDGICVSQESELEAALTKALAAQVPFVVDINLDPKQPAPIGGRIRSLIEQGA 585 Calothrix rhizosoleniae
WP_012408691 513 GFHNVDAEIPSPDFVMIARGMGADGIRVSRECDLEAALEKALALTIPFVVDVIIDPTRPAPIGSRINSLIFHGK 586 Nostoc punctiforme
WP_012408718 528 GYESMDVEIPQTDFVMLARSMGADGIRVEKESDIQAALEIAMASTSPFVIDVLIDHTRLAPIGTRIFSLMSQGA 601 Nostoc punctiforme
WP_017317769 533 GFKGVDTEIPNTDFALMAKAMGADGIRVNTESDLEAALEKALLSTVPFVVDVSIDSTQAAPIGGRIRSLIKQGA 606 Mastigocladopsis repens
WP_017743047 519 GFKGVDTEIPCTDFVMLAKAMGADGICVKRESDIEIALETALLSSIPFVVDVRIDATQLAPIGGRIRSLIEQGA 592 Scytonema hofmannii
WP_017747608 545 GYEGMDTAIAQADFAKIACGLGATGIRVERESEIQAALEKAMNSKSPVVVDFIIDPTQLAPIGGRIQSLISQGA 618 Scytonema hofmannii
WP_038084134 501 GLKDMDTDIPQVDFVKVACAMGADGIRVQKESEIQQALEKAIASPVPFVVDVVIDPTEPVPIKGRIDSLISQTT 574 Tolypothrix bouteillei
WP_038296497 545 GLIGVDTEIPRSDFVKIATGMGACGIRVEKESDLEAALEMALTSKAPFVVDIQIDPTRPAPIGGRIQGLISQRT 618 Nostocales
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap