Conserved Protein Domain Family
Geo26A_fam

?
NF035925: Geo26A_fam 
geobacillin-26 family protein
Statistics
?
PSSM-Id: 468265
Aligned: 35 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_053996763             21 TTANILVDNASTRVVEAKD-DSNIYIATNDKQTNNITIETYDLERnl--lSTEVLDGNQIPTEendynldnlpfeeiqis 97  Lysi...
PRJNA503267:EEL30_15750  45 YRIEILEDNDSVRIVRVES-ENGIIEATYDKMNHTIEFDEDGTITq----VSIADSDEQVEKE----------------- 102
WP_031414495             45 DKIGILEDSGSVRVVRVES-ENGINEATYDKVNHTIEFDEDGTITq----VSIADSAEQVKKEk---------------- 103 Brev...
WP_104032929             45 YKIEILEDNDSERVVRVES-ENGITEAAYDKINHTIEFDEDGTLTe----VSIADPEEQIKKE----------------- 102 Brev...
WP_113755909             49 YKVEIIKDNKLERTVRITT-ENSTIEATYDKMKNILKFDEDGVITe----INLEQ-EEVSEEKd---------------- 106 Brev...
WP_036691256             39 FTIDILEDSTTIKKVQVTN-DSMTYITVYDKVNNSVTTEEISLANteestFKKGNSQNVVNSFtldlna----------- 106 Paen...
CEK34494                 46 LKIKTIEDTDEKKVVEVME-GEKISTSTFNKKDNTLK-LEIKENGk----IIQDSYINLNNDNn---------------- 103
WP_021383423             46 ISVNILEDNSEKRVVEVIS-NDTKTVVTYDKINNIITGDEVNLNTa----EKNYINIDLNDTSs---------------- 104 Clos...
WP_092335625             43 ITTEVLADNDSLKTVKVTEdKEKTYVVTYDKKANELTTVETDMHTg--------KSKNTVAKLk---------------- 98  Desu...
WP_073093604             45 YTYKIVVDDDTKRQVKAPDg----TIATYFKENNVIEIFAEDSTIt------IDLNDDFIKQ------------------ 96  Ther...
WP_053996763             98 eedilfENVMPLAAQSNYKLLQTVNLQEAYGYWIYSTNQ----GEIWMIKLRTGE---MKSTfYKGDNKTHFNDFKRSVD 170 Lysi...
PRJNA503267:EEL30_15750 103 ------KQKQSKIAAFAEKNIVRQSHEQYYGYYYVIDKSg--sNRYWDVGNGKKG---TYVK-QTSVNQDDLFDFEDKVD 170
WP_031414495            104 -----yKQKQSKMAAFAKKDIVREAHEPYFGYYYVIDKSg--gKKYWDVGNGKEG---TYVK-QTSSNKDDLFHYEDKVN 172 Brev...
WP_104032929            103 ------KDRQKR----SAKDIVRSAHEKYYGYYYVIDKSr--gKKYWDVGNGKEG---TYVK-QTSSNKADLFDYEDKVL 166 Brev...
WP_113755909            107 -----sSEKIRAKRATSDRERIESTSVAYYDYYYKIYEYkd-gSLYWDIGNGKKG---KYIK-QTKKNKNDLYNYQDQLD 176 Brev...
WP_036691256            107 -leeqsNNIGNAAARGIYEGLISYKITTFWDIKYFVHKFtlptSYSWTLECDRGA---KRDIeENSSNASTLESYRLAVN 182 Paen...
CEK34494                104 -----iQNYIEPRATRAQESVRCIYSKLRYSINMKS----------WTITNSKGS---VKKRpETVSHKDYLYRFRDAVK 165
WP_021383423            105 -----yDNDNSISSRKAQITNSSRFSKIYYAANGKK----------WSIKNTKGS---LKGRtETSKNSVNLYRFKDAVD 166 Clos...
WP_092335625             99 ------LNSKANEINTAAASSSYSNFGMFFDGSYYVTNT------TWLIENSDEE------SkYRTSDSTVLYNFKAAVD 160 Desu...
WP_073093604             97 ----------QETIELQSNIFWENQGIYNWKYRYIKYVD-----QRWQLRIAYGLgfqSYMTnENTNNRPYLFEFKNCVD 161 Ther...
WP_053996763            171 NFMASKNQLVAKVGTGILTTIATLYLVPEPVWT-KIVATLITIVGAAIAYAECKAMFDAYSNSRLYYSRV 239 Lysinibacillus...
PRJNA503267:EEL30_15750 171 ELIKAEALLVVNTTVSGSAFMASVKDIKSGWGAdRLIAFFAGAGFGMAAAVNAADVVLAEKKAARAFDNI 240
WP_031414495            173 ELMKAEALLVVNTSISFSAFLASAKGIKSGWGAdSMIAFFAGAGFGLVAAVNATDVVLAERKAAHAFDSI 242 Brevibacillus ...
WP_104032929            167 DLIKAEATFVATSTVSLSALMASVKGIKSGWGAdRMIAFFAGAGFGMTAAVNAADMVIIERKVARAFDII 236 Brevibacillus ...
WP_113755909            177 ELLRREAVLALSSAGAVAAAKQAISSARASWPEeKILASFAALGFAGWAGSNLLDIFLQERKVKRAFRDA 246 Brevibacillus ...
WP_036691256            183 NVNKKQVEAVAVGGTALATTIAAGAA--AATGVgAIVSLVTAIGGSITVAYLFWDAKQSANDANYFFERV 250 Paenibacillus ...
CEK34494                166 ASRRSENLAEASMGAAKIAAIYGIVT--AATGVgAVVSVVTAAGGSLGAAYNLWDSVIEKREADRYFAIL 233
WP_021383423            167 SCRKLENASSRGMDTTKLGLAIAGVT--AETGVgAVIGIFTAIGGASSAAYKFYDSLQYRKEADRLFSML 234 Clostridioides...
WP_092335625            161 NMVRSENAAITAGGVAICGAVVGTLT--APTGIgAVIGAVTALGGSITCANKLWDAWSYQDDVDFYWDRA 228 Desulfosporosi...
WP_073093604            162 TIKSCEQN----IAAAGFGALLSLFGg-------PLIAALTAAGASGVIIANANQLNNAIDDANTIFWYL 220 Thermosyntroph...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap