Conserved Protein Domain Family
scytonem_ScyC

?
NF035924: scytonem_ScyC 
scytonemin biosynthesis cyclase/decarboxylase ScyC
Of the various markers of scytonemin biosynthesis, ScyC appears to be the clearest, as there are few or no close homologs from outside of the set of confidently predicted scytonemin producer bacteria.
Statistics
?
PSSM-Id: 411513
Aligned: 15 rows
Threshold Bit Score: 621.737
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_136921529      5 EKNTFIISSYIASPLEATYDYLCRLENLGEWTLYSRMKEQIDESTWRGSSSGYQADLYYHIRKTEGLPFRGIEWHCGIEY 84  Polyangium s...
WP_009631719      2 EKNTFATSAFIATTPETAFDYLSKLENLDEWTLFSRMIEQIDADTWLGTASGYQNNLYYHIKKLQHPLFYGIEWHCGVEY 81  Synechocysti...
WP_017317590      4 ERNTFATSAYIATSPQSAYEYLCSLKNLGEWTLYSRMEEQVDEDTWLGTASGYQRKLYYHVKRLDHPHFYGIEWHCGLEY 83  Mastigoclado...
1_ncbifamImport   1 EDNTFATSAYIATSPEKAFDYLCSLKNLDDWTLFSRMIEQVDENTWIGTASGYQRNLYYHVKKIENPLFYGIEWHCGFEY 80 
2_ncbifamImport   1 ERNTFATSAYIATEPQTAFEYLCSLKNLDEWTLFSRMIEQIDENTWRGTASGYQSDLYYHVRKIEHPYFYGIEWHCGLEY 80 
PSO52093          4 EENTFATSAYIATSPETAFDYLCHLENLNEWTLFSRMKEQVDENTWLGTASGYQRNLYYHVRKIENQPFYGVEWHCGFEY 83  Cyanobacteri...
WP_009783077      2 EQNTFATSAYIATDTDTAFDYLCSLKNLDDWTLFSRMIEQVDEDTWLGTASGYQHNLYYHVKRIDNGFFKGIEWHCGIKY 81  Lyngbya sp. ...
WP_107668093      2 EENTFATSAYIANSPEIVFNYLCSLENLNDWTLYSRMIEKIDDQTWLGTASGYQNNLYYHVRPIENASFRGIEWHCGFEY 81  Cyanothece s...
WP_106455945      2 EENTFATSAYIATSLETTFDYIYSLENLNDWTLYSRMIEQIDENTWLGTASGYQNNLYYHVRKIENCAISGIEWHCGFEY 81  Aphanothece ...
WP_013322486      2 EQNTFATSAYIDNSPETVHDYLCSLENLNDWTLYSRMLEQVDDNTWLGTASGYQHNLYYHVKKIEHPTIKGIEWHCGIEY 81  Gloeothece v...
WP_136921529     85 DKYFQIYPVFLFPPHYIEPGSDEEGVYFHWVSFADPRRCRPMFMEGIQTVHTSECRSLKGALERRAGRSEAARGRYRIET 164 Polyangium s...
WP_009631719     82 NQYFQVYPVLLFPPEYIEPGTDEQGVYFHWLSFVDPIRRPQMIMEGIHTVHSSECRSLKGNLERKAGLTQAAKGRYYIDV 161 Synechocysti...
WP_017317590     84 QKYYQVYPVLLFPADYIEPGTDEKGVYLHWISFVDPKRRSPLIMEGIHTVHTSECRSLKGNLERKAGLSAAAKGRYFIEA 163 Mastigoclado...
1_ncbifamImport  81 KKYFQVYPVLLFPPSYIEPGSEEEGVYFHWLSFVDPKRRTPMIMQGIHTVHTSECRSLKAILERQAGRTRAAEGRYAIAT 160
2_ncbifamImport  81 QKYFQVYPVLVFPTDYIEPGTDEKGVYFHWLSFVDPARRNPMIMEGIHTVHTSECRSLKAILERKAGLTEAAQGRYRIDT 160
PSO52093         84 NHYFQVYPVFVFPASYIEPDSDEAGVYFHWLSFVDPDRRTPMIMQGIETVHTSECRSLKGILERNAGHTEPAAGRYTIAT 163 Cyanobacteri...
WP_009783077     82 QEYFQVYPVMLFPPEYIEPGTDESGVYFHWLSFVDPKRRVPMIMQGIETVHTSECRSLKAILERQAGRTEAAVGRYKIVT 161 Lyngbya sp. ...
WP_107668093     82 QKYFQVYPVLLFPPEYIEPGTEEKGVYFHWLSFIDPKRRTPMIMQGIETVHTSECRSLKAILERQAGQTQAISGRYRIET 161 Cyanothece s...
WP_106455945     82 QKYFQVYPVFLFPANYIAPDTDETGVYLHWLSFVDPKRRTPMIMQGIETVHTSECRSLKAILERQAGHQEAAQGRYRIST 161 Aphanothece ...
WP_013322486     82 QKYFQVYPVFLFTPQYIDPNSDESGVYFHWLSFVDPKRRTPMIMEGIETVHTSECRSLKAILERKAGHTSAAVGRYKIDT 161 Gloeothece v...
WP_136921529    165 VTIFVDAPVELGAAYLSDVRNLKEWAHLLRAQGDVGPEAGDFVDEYGQRVRAAFRAHALDRYHMIEHDYTYPDHGgFMQR 244 Polyangium s...
WP_009631719    162 DTMYIDAPVEMGAEYLKDVRNLDEWAHLLHPRGEIMPESGEFVDEYGQKVQVKFRINNLSKYYLLEQEYFYPDYN-YYQK 240 Synechocysti...
WP_017317590    164 DTIYVNAPIEMGVEFLSDLRNMDDWAHLLRADGEITPSSGEFRDEYDQKVKVTQRVQPVSKWYLLEHEFFYPDYG-FYQR 242 Mastigoclado...
1_ncbifamImport 161 DTMYIDAPLELGVEYISNLKNIDEWAHLLRPDGEITSQYGEFRDEYNQKVNVTFRLHNMNNYYLLEQDYYYPEYK-FYQR 239
2_ncbifamImport 161 DTIYIDAPASVAKDYVSDLHNLDEWAHLLRPNGEITSQSGEFLDEYNQKVKVTFRTHDLKNYYLIEQDYYYPDYN-FIQR 239
PSO52093        164 DTIYIDAPLELGAEYIADLRNTDEWAHLLRSRGDVSSTSGEFLDEYDQTVKARYRKHALSSYYLIEQDYYYPDYG-LYQR 242 Cyanobacteri...
WP_009783077    162 DTIFVDAPIEMGYEYLSDLRTMDEWAHLLRPAGEISSKEGEFLDEYNQTVKVELRSHTLSKYYLIEQDFYYPDHN-FTQR 240 Lyngbya sp. ...
WP_107668093    162 DTIYVNAPVELGFEYLKDLRNMDDWAHLLRAKGKINPTQGTFLDEYDQIVEVEFISHDLNNYYLIEQNFFYPQQN-FMQR 240 Cyanothece s...
WP_106455945    162 DTIYIDAPIEMGFEYLKDMKNTEDWAHLLRAKGEITDDKGEFIDEYNQNVTVTFTAYDLKNYYLIEQDYYYRDRN-FYQR 240 Aphanothece ...
WP_013322486    162 NTMFVDAPIELGFEYLRDLRNMDDWAHLLRSTGKLNPEGGEFLDEYAQKVTVTLRTHALNKYYLIEQNYFYPEHN-FIQR 240 Gloeothece v...
WP_136921529    245 SPALLIPCSYAFNDPSASGFVLHRITFWRTDEAPRRGRLLLEDYGAESMNIKRFLEAQAGNVASFERGWSYIP 317 Polyangium sp. SDU3-1
WP_009631719    241 SPAILIPCAYAFNDPSASGFIQHRISFWKVGETLPHGKLQIEDYGAESMNIKRTLEAKAGNTETFARGMSYIP 313 Synechocystis sp. P...
WP_017317590    243 SPVLLIPASHAFGDPEAPGFIQHRITFWKVGEHLPHGKLQIEDFGSESLNIKRLLEAKAGNFDTLAQGLSYMP 315 Mastigocladopsis re...
1_ncbifamImport 240 CPAILIPCSYAFGDPSARGFIQHRITFWKVGKTYRHGKLQMEDFGAESMNVKRLVEAKAGNTETFARGMSYMP 312
2_ncbifamImport 240 CPVFIIPCSYAFGNSSAQGCIQHRITFWRQDKPHRHGKLQLEDFGAESMNIKRISEAKAGNFDTFARGMSYLL 312
PSO52093        243 SPVLLIPCSYAFGNSSAGGFIQHRITFWKPGETPRHGKQQIEDYGAESMNIKRLLEAKAGNLETFARGMSYIS 315 Cyanobacteria bacte...
WP_009783077    241 SPSIIIPCSYAFADPDAEGFIQHRITFWPLDKPLRHGKLQIQDFGAESMNIKRFLEAKAGNLETFAQGMSYQP 313 Lyngbya sp. PCC 8106
WP_107668093    241 CPTLLVPCFYAFGDDDAQGFIQHRITFWPIGQSFSHGKLQIQDYGAESMNIKRLLEAKAGNTDSFAKGMSYQL 313 Cyanothece sp. BG0011
WP_106455945    241 CPVVIIPCSYAFGDPSARGFIQHRITFWPVDQPLRHGKLQIQDFGAESMNIKRILEAKAGNTDTFARGMSYQL 313 Aphanothece hegewaldii
WP_013322486    241 CAVVIIPCSYAFGDPSAQGFILHQITFWPVDHPLKHGKLQLQDFGAESMNIKRLLEAQAGNTQSFAQGMSYRP 313 Gloeothece verrucosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap