Conserved Protein Domain Family
Trp_DH_ScyB

?
NF035922: Trp_DH_ScyB 
tryptophan dehydrogenase ScyB
The tryptophan dehydrogenase (EC 1.4.1.19) ScyB performs a reversible NAD(+)-dependent deamination of L-Trp to 3-indolepyruvate. ScyB occurs in Cyanobacteria that biosynthesize scytonemin, a natural sunscreen, from tryptophan.
Statistics
?
PSSM-Id: 411511
Aligned: 10 rows
Threshold Bit Score: 672.212
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015117780  24 RMNQAAKEMGHEDVFFCHDKEANLIAMIAIHDKGLGAgqSMGATRLWPYTNQEHALKDVLRLSRGMTYKAACANIPVGGA 103 Rivularia sp. P...
WP_012408017   2 LLFETVREMGHEQVLFCHGKNPEIKAIIAIHDTTLGP--AMGATRLMPYVNEEAALKDALRLSRGMTYKAACANIPAGGG 79  Nostoc punctiforme
WP_015137264   2 QLFETVREMGHEQILYCHGKNPDIRAIIAIHDTSLGP--AMGATRLFPYVNEEAALRDALRLSRGMTYKAACANIPAGGG 79  Nostoc sp. PCC ...
WP_019493559   3 NLFENVSEMGHEQVLFCHGKDPDIKAIIAIHDTTLGP--AMGATRLYPYANEEAALNDALRLSRGMTYKAACANIPAGGG 80  Calothrix sp. P...
WP_017317589   2 NLFKTVTEMGHEQVLFCHGKDPDIKAIIAIHDTSMGP--AMGATRLLPYATEEAALKDALRLSRGMTYKAACANIPVGGG 79  Mastigocladopsi...
WP_015118016   2 NLFENVTEMGHEQVLFCNGKDPDIKAIIAIHDTSLGP--AMGATRMLPYVSEADALKDALRLSRGMTYKAACANIPVGGG 79  Rivularia sp. P...
WP_009631720   2 KLFETVEEMGHEQVLFCHGQNPNIKAIIAIHDTSLGP--AMGATRMLPYVDESAALKDVLRLSRGMTYKAACANIPVGGG 79  Synechocystis s...
WP_013322485   2 KLFETVSEMGHEQVLFCHDKARNLKAIIAIHNTNLGS--AMGATRLWPYLSEADALRDVLRLSRGMTYKAACANIPMGGG 79  Gloeothece verr...
WP_009783078   2 KLFETTATAGHEQVLFCNDQASGLKAIIAIHDSRLGA--AMGATRLWPYESEVAALTDALRLSRGMTYKAACANIPMGGG 79  Lyngbya sp. PCC...
WP_015155131   2 KLFETVKEMGHEQVLFFQDKELNFKAIIALHDTSLGR--AMGATRLFPYASEEDALQDVLRLSRGMTYKAACANIPVGGG 79  Chroococcidiopsis
WP_015117780 104 KAVIIAKPEQKSERMLRAYGRFVESLEGRFITGQDVNISTEDVRVIRQETKHVVGVSEKCGGPVPMTAMGVVLGIKAAVK 183 Rivularia sp. P...
WP_012408017  80 KAVIIANPENKTDDLLRAYGRFVNSLNGRFITGQDVNITPDDVRTISQETNHVVGVSEKSGGPAPITSLGVFLGIKAAVE 159 Nostoc punctiforme
WP_015137264  80 KAVIIANPEDKTEEMLRAYGRFVESLKGRFITGQDVNITPQDVRTIKQETNYVVGVEEKSGGPAPITALGVFLGIKAAVE 159 Nostoc sp. PCC ...
WP_019493559  81 KAVIIAKPEQKTDELLRAYGQFIQKLNGRFITGQDINLTPADVRTISQETRFVVGVEEKSGGPAPVTAWGVFLGIKAAAQ 160 Calothrix sp. P...
WP_017317589  80 KAVIIAHPEKKTEDLFRAYGRFVESLKGRFITGQDVNLTPDDVRTISQETKYVVGVEERSGGPAPVTAWGVFLGLKAAVE 159 Mastigocladopsi...
WP_015118016  80 KAVIIGNPAHKTDELLYAYGRFVNSLNGRFITGQDVNMTPEDVRKISKETNYVVGVEEKSGGPAPVTGWGVFLGLKAAVE 159 Rivularia sp. P...
WP_009631720  80 KAVIIANPAEKSDELFEAYGRFIENLNGRFITGQDVNITPQDVCTIRRQTSYVVGTSEKSGGPAPITARGVLLGIKAAVN 159 Synechocystis s...
WP_013322485  80 KAVIIANPQDKNDELLRAYGRFVNSLNGRFITGQDVNLSPEDVRQIYKETQYVVGRSEKSGGPAPMTAMGVLLGIKAAVE 159 Gloeothece verr...
WP_009783078  80 KAVIIAKPEQKTCELLQAYGRFIERLNGRFITGQDINLTPQDVRQINRETKYVVGTQEKSGGPAPVTAIGVLLGMKAAAK 159 Lyngbya sp. PCC...
WP_015155131  80 KAVIIANPDQKTDKMLRAYGRFVDSLQGRFITGQDVNICPEDVQEMRRETRYVVGLTGKAGGPAPATALGVFLGIQAAVF 159 Chroococcidiopsis
WP_015117780 184 FRLHKENLNGLSVAIQGVGNIGKNLCQQLHEHGVKLFVTDTIKERAEEVKDLYGAIVVNSDEIYSLNVNVFAPCALGGIL 263 Rivularia sp. P...
WP_012408017 160 SRWQSKRLDGMKVAVQGLGNVGKNLCRHLHEHDVKLFVSDVDPAKAEEAKRLFGATVVEPTEIYSLDVDIFSPCALGGIL 239 Nostoc punctiforme
WP_015137264 160 FRWQTKTLEGMKIAVQGLGNVGKNLCQHLHEHGAKLVITDINLKKVAEIKCLFGATVVEPEEIYSQDVDIFAPCAMGGII 239 Nostoc sp. PCC ...
WP_019493559 161 FQLKTVDLQGIKVAVQGLGNVGKNVCQHLYENGAKLYVTDISPEKAEEIRNLYGATVVEPDEIFSQDVDIFSPCAMGGIL 240 Calothrix sp. P...
WP_017317589 160 FRLHTQDLKGLKVAVQGLGNVGQNLCRHLYEHGAKLFVTDISQEKTEQVKRLFGATVVEPDEIYSLDVDVLSPCALGGIL 239 Mastigocladopsi...
WP_015118016 160 FRLKTSDLKGLKVAVQGLGNVGTNLCRHLHENGAELFVTDINPERTAEIKNLFGATVVEPSEIYQLDVDVFSPCALGGTL 239 Rivularia sp. P...
WP_009631720 160 FRLQNRSLEGLKVAVQGLGNVGGNLCAYLHEHGVELYVTDVNREKAEQAASLYAAKVVDPDEIYGLDVDVFAPCALGGIL 239 Synechocystis s...
WP_013322485 160 FRMQQTNLEGLTVAVQGLGNVGQNLCKHLHEHKVKLFVSDIDAKKAEKMQQLYGATVVESKEIYNLDVDIFSPCALGAII 239 Gloeothece verr...
WP_009783078 160 YRFGSDNLKGLKVAVQGLGNVGQHLCDWLHQNEVKLFVSDINQAKVSKVARLYGATAVEPEQIYGLDVDIFAPCAMGAIL 239 Lyngbya sp. PCC...
WP_015155131 160 FQFNKQDLNGLRVAVQGLGNVGGKLCDYLHRRGVKLFVTDLNHNRAEEIKQLYGAKVVEPEDIYSLDVDIFAPCAMGAIL 239 Chroococcidiopsis
WP_015117780 264 NSSTIPLIKAPIIAGAANNQLEDEQIHSKLLESKGILYCPDYVINAGGLINVYNEMIDTDEEHI-LKQVNNIYNTLLDIF 342 Rivularia sp. P...
WP_012408017 240 NSHTIPFLQAQIIAGAANNQLENEQLHSQMLTRKGILYSPDYVINAGGLINVYNEMIGYDEEKA-FKQVHNIYDTLLAIF 318 Nostoc punctiforme
WP_015137264 240 NSQTIPQLQAKIIAGAANNQLENERLHSQRLAEKGILYSPDYVINAGGIINVYNEMIGYEEEKA-FQQVHNIYDTLLRIF 318 Nostoc sp. PCC ...
WP_019493559 241 NSQTIPQLRASIIAGAANNQLGQEKLHGQMLTDKGITYCPDYVINAGGLINVYNEMIGYNEEKA-FQQVNNIYDTLLEIF 319 Calothrix sp. P...
WP_017317589 240 NSETIPCIKAAIIAGAANNQLGVEALHSQMLTAKEILYCPDYVINAGGLINVYNEMIGYNEQRA-FQQVNNIYDTLLEIF 318 Mastigocladopsi...
WP_015118016 240 NAQTIPQIKAKVIAGAANNQLGQEKQDGMMLVEKGILYAPDYVINAGGLINVYNEMIGYNEEKA-FRQVRNIYNTLLDIF 318 Rivularia sp. P...
WP_009631720 240 NSETIGQIKAPIVAGAANNQLENEQQHSQALRLMGILYCPDYVINGGGLINVYNEMIGYDETKA-FQQLNNIYDTLSEIF 318 Synechocystis s...
WP_013322485 240 NSSTIPLLKAKIIAGAANNQLENEVLHSRLLEDKGILYCPDYVINAGGLINVYHEMIGYEEEKA-FTHLNSIYNTLLQIF 318 Gloeothece verr...
WP_009783078 240 NTQTISQMKASIIAGSANNQLLDEQVHGEMLTAQDILYCPDYVINAGGLINVYHELIGYQEKKA-ISHVHSIYDTLLELF 318 Lyngbya sp. PCC...
WP_015155131 240 NSETIPLIQASIIAGCANNQLQDENIHSAMLKSKGIIYCPDYVINSGGLINVYHELT-FSDEASyLKQIHSIYDTLLEIF 318 Chroococcidiopsis
WP_015117780 343 KISEEEEINTHEAAKLLAEERIMKAKNFN 371 Rivularia sp. PCC 7116
WP_012408017 319 DIAKEQGVTTNDAAKRLAEDRISNSKRSK 347 Nostoc punctiforme
WP_015137264 319 EIAQQQRITTNEASKRLAEERIMQARISK 347 Nostoc sp. PCC 7524
WP_019493559 320 TRAHERGITTNDASKLIAEDRIMKARKST 348 Calothrix sp. PCC 7103
WP_017317589 319 DRAQKQEITTNDASKQLAEDRILKARHLK 347 Mastigocladopsis repens
WP_015118016 319 DRAENQQITTDDASKQLAEERIANAKNIK 347 Rivularia sp. PCC 7116
WP_009631720 319 AIAHHAEITTYEASRRLAQERIAKAKSLK 347 Synechocystis sp. PCC 7509
WP_013322485 319 SLAKSQEITPYEAAQKIAENRIMNAQPLG 347 Gloeothece verrucosa
WP_009783078 319 KKAETTGMTTHKASMQLAEERITQAEQAQ 347 Lyngbya sp. PCC 8106
WP_015155131 319 TKSKAENITTQDASKRLAEERILKARKLA 347 Chroococcidiopsis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap