Conserved Protein Domain Family
alph_xenorhab_B

?
NF033927: alph_xenorhab_B 
alpha-xenorhabdolysin family binary toxin subunit B
Statistics
?
PSSM-Id: 411488
Aligned: 29 rows
Threshold Bit Score: 163.184
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_016779465    102 RVSRIASAaraaKEQIEMRAVEGEGLNLEHYSDPLLIYDAARLEELEQQAVDLQVEEDRLRADKQVIDAAVTLLQSRTWL 181 Pseudomonas ...
WP_015833675    118 DVKNVISNlhkeANIMANKIADVRNVVIVERLEESLKEELERKTELQADIAQKEQNKAKLLPDRNKIIESQDIIRQYNLA 197 Photorhabdus...
ABB52644        117 DIDNVIVSftgrTNKLTNKISDISDMVIAERLQDLVTQAESQKTELQSDIDPKTEKRNKLDADREKIIESQDVIRQNNIA 196 Xenorhabdus ...
WP_012988210    117 DVDQVISNvrdeTNQLTGKINDIRNMVISERLGDLLTQAQSQKTELQSAIEQKSAEQNKLDAARAKIIESQDVIRQNNIA 196 Xenorhabdus ...
WP_011146223    117 DIDNVIANfddrINKLTGKINDINDIVIAGHFEDVLAKTKKQKAELQSDIEQKTKERKKLDAERDKIIESQDVIRAKNIA 196 Photorhabdus
1_ncbifamImport   1 DITQLKQLfiekTELLDKSSSDLHNVVIIEGTDKVLQAEQLRQKQLTEDIATKELERKEIEKKRDKIIEALDVIREHNLV 80 
WP_004243678    112 ELTESIEIiekhISFINDKKQLLTTTTIISEIDKLIRNKEEISIEINEKIAKQKLSINEIKEQLDIITKSEDIIYNKNIL 191 Proteus
WP_006815524    104 DLIDIKTElenlISKTRYTLESLLVFHLNEPNMLKLSQYTSQKESLVNSKNGKQLKVNELNNNLSVIMAAEDIILKHKIT 183 Providencia ...
WP_006660296    104 DLLDIKSEleklIAKTRYALESLLVFHLNEPNKLKHSQYLKQKEFLVNSKNGKQSKINELNNHLSIILAAEEIILKHRIT 183 Providencia ...
WP_004259854     95 DLIDFKLEleriITKFSYTTDSLSLIHVEESNQHKLQQYAEQKELLVTSKNSKMLKINEINQQHSVITAAEDIILKSKIT 174 Providencia
WP_016779465    182 DHVRDLLPTPEQIQglvsTALVGRADADTVIAAL----ERLTQYLGVYDGGFRLFSLTEARNKISDRLVDLRTLSNKNKT 257 Pseudomonas ...
WP_015833675    198 DMFKDYIPNVSELD----KLNLDSPKKELIKQAIkqgiEIAKKILGNISTGLKYIELADARIRLDAQISQLSKDCDDLKT 273 Photorhabdus...
ABB52644        197 DMFKDFIPSAKDID----GLDFTQPKKEAIKQAIkqgaEIARKILGKVSEGLKYIDLADARMKLSDQIDQLITETDELKA 272 Xenorhabdus ...
WP_012988210    197 DMFKDFIPSASDID----KLDFTQPKKEAIKQAIkqgvEIARKILGKVSEGLKYAELADARVKLSDQIDQLTKESDTLKT 272 Xenorhabdus ...
WP_011146223    197 DMFKDYLPNTNDID----GLNFAQPEKEIIKQSI----EIVKKVLGKISEGLKYIDLENARMKLTEQIDHTMQESKALKT 268 Photorhabdus
1_ncbifamImport  81 DAFKDLIPTGENLS----ELDLAKPEIELLKQSL----EITKKLLGQFSEGLKYIDLTDARKKLDNQIDTASTRLTELNR 152
WP_004243678    192 DFFTSHLPSKQTIS----KLQLASSEKDILSVFI----DLLKQFFTHLEKGFSYQKLVETRHTLIDNYLIQIKNLTKLEQ 263 Proteus
WP_006815524    184 DFFDKYFQGKELID----SIDIQPNKKDILKAAI----SYIRNLLTMVDDGLQFSQLVDVRIYLSDKIIELREEINTLDN 255 Providencia ...
WP_006660296    184 DFFDKYFQGKELID----SIDIQPNKKDILKAAI----SYIRNLLTMVDDGLEFSQLVDVRIYVSDQIIEAREEINTIDN 255 Providencia ...
WP_004259854    175 DFLKKHLLNDELID----SIDMPTNKKQILKSAI----AFIKNLLSVIDDGLEFAQLVEVRLDLGNQILELKEEVNHIDK 246 Providencia
WP_016779465    258 DARVLQERAQKIRRHAELVEVRACWVANIRLVAKGMGVFIARVRATTEVdEHLLRQTSAELAGFLGFLRRIS 329 Pseudomonas fragi
WP_015833675    274 QLKDVEQRIAGIENAHQIDKERTTLLLQATKLEQIWIIFANQLQETIED-QSSQQNLTKLIHDQLDYLDNLE 344 Photorhabdus asymbio...
ABB52644        273 KIREVELRLSGLKDVMQIDTERTTLLTEAVKIEQVWISFAEQLHKLSND-EINQQDLSNLINGQLDFLNNLT 343 Xenorhabdus nematophila
WP_012988210    273 TLRETEQRLAGITDTIQIDEERTTFLAEAVKLEQTWNLFANQLRNLSGN-QINQEDLTSLINSQLDFLGNLA 343 Xenorhabdus bovienii
WP_011146223    269 TLEETELRLSGLKDVMQIDTERTTMLNEVGKLEKAWRLFSSQLHELSDK-NINQDYLTNLINGQLNFLDNLV 339 Photorhabdus
1_ncbifamImport 153 QLEQSEKLIAGVNAVIKIDQEKSAVVVEAEKLSRAWHIFIHEITALQGT-SLNEVELSKPLIKQQIYLESLI 223
WP_004243678    264 KKQALLFTLSRYYAVTEINQYIDMLNQQLSLLEQYWHTLIEQLIQL----KRNLSEAKTVLSPHLVFLNHFS 331 Proteus
WP_006815524    256 NIFRLTQLMAYSSDITAIETYKQTIITQVGLLKVYWESWCHFIGEKILDkTIDLAQINMASQMLMTYLNDVE 327 Providencia rustigianii
WP_006660296    256 NIFRISQIISYANDISQIESHKQTIITQTGALKSYWESWCGFMSEKISEeCLNLEHIKTMSQMFMTYLNDIE 327 Providencia alcalifa...
WP_004259854    247 TIFKLSQLMLLSEQITAIDSHKLSIITQIGLIKNYWWEWCHFINEKSSEkTVNIQKINTASQVLMSFLDDME 318 Providencia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap