Conserved Protein Domain Family
L_lactate_LldD

?
NF033901: L_lactate_LldD 
FMN-dependent L-lactate dehydrogenase LldD
LldD is an FMN-dependent L-lactate dehydrogenase. It occurs in E. coli, Salmonella, and as one of two L-lactate dehydrogenases in Pseudomonas aeruginosa. It is unrelated to the NAD-dependent enzyme.
Statistics
?
PSSM-Id: 411463
Aligned: 40 rows
Threshold Bit Score: 778.618
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013792696   1 MIISASTDYRAAAKRRLPPFLFHYIDGGAYAEYTLKRNVEDLAGIALRQRVLKNMAELSLETKLFGETLSMPVALAPVGL 80  Pseudomonas fulva
WP_014037557   1 MIISASTDYRAAAQRRLPPFLFHYIDGGAYAEHTLKRNVSDLSDIALRQRILRNMSDLSLETELFGETLAMPVALAPVGL 80  Stenotrophomonas
WP_015673648   1 MIISASTDYRAAAQAKLPPFLFHYIDGGAYAEHTLQRNTADLADIALRQRVLRNMSELSLETTLFGEKLAMPVALAPVGL 80  Serratia
WP_004959099   1 MIISASTDYRAAAQAKLPPFLFHYIDGGAYAEHTLRRNTADLADIALRQRILKNMSELSLETTLFGEKLAMPVILAPVGL 80  Serratia odorifera
WP_019455688   1 MIISASTDYRAAAQAKLPPFLFHYIDGGAYAEHTLKRNTADLADIALRQRVLRNMSELSLETTLFGEQLAMPVALGPVGL 80  Serratia
WP_013814335   1 MIISASTDYRAAAQAKLPPFLFHYIDGGAYAEHTLRRNTEDLADIALRQRVLRNMSDLSLETRLFGEKLAMPVILGPVGL 80  Serratia
WP_017893841   1 MIISASTDYRAAAQAKLPPFLFHYIDGGAYAEHTLRRNMEDLAGIALRQRILRNMSDLSLETSLFGEKLAMPVILGPVGL 80  Serratia sp. S4
WP_009110954   1 MIISASTDYRAAAQRKLPPFLFHYIDGGAYNEHTLRRNTADLADIALRQRILKNMSELSLETQLFGEKLAMPVALAPVGL 80  Brenneria
WP_011091762   1 MIISASTDYRAAAQRRLPPFLFHYIDGGAYGEHTLRRNTADLADIALRQRILKNMSDLSLETQLFGEKLAMPVVLAPVGL 80  Pectobacterium ...
WP_004721492   1 MIISASTDYRAAAQAKLPPFLFHYIDGGANAEHTLRRNTEDLSGIALRQRVLKNMSELSLETKLFDEILSMPVVLAPVGL 80  Yersinia ruckeri
WP_013792696  81 TGMYARRGEVQAAKAAADKGIPFTLSTVSVCPIEEVAPAISRPMWFQLYVLKDRGFMKNALERAKAAGVTTLVFTVDMPT 160 Pseudomonas fulva
WP_014037557  81 TGMYARRGEVQAARAADSRGIPFTLSTVSVCPIEEVAPAIQRPMWFQLYVLRDRGFMRNALERAQAAGVTTLVFTVDMPV 160 Stenotrophomonas
WP_015673648  81 TGMYARRGEVQAARAAANKGIPFTLSTVSVCPIEEVAPAINRPMWFQLYVLKDRGFMRNALERAQAAGVKTLVFTVDMPV 160 Serratia
WP_004959099  81 TGMYARRGEVQAARAAAAKGIPFTLSTVSVCPIEEVAPAIDRPMWFQLYVLKDRGFMRNALERAQAAGVKTLVFTVDMPV 160 Serratia odorifera
WP_019455688  81 TGMYARRGEVQAARAAAQKGIPFTLSTVSVCPIEEVAPAIDRPMWFQLYVLKDRGFMRNALERAKAAGVKTLVFTVDMPV 160 Serratia
WP_013814335  81 TGMYARRGEVQAARAAAQKGIPFTLSTVSVCPIEEVAPAIDRPMWFQLYVLKDRGFMRNALERAKAAGVKTLVFTVDMPV 160 Serratia
WP_017893841  81 TGMYARRGEVQAAKAAAQKGIPFTLSTVSVCPIEEVAPAIDRPMWFQLYVLKDRGFMRNALERAKAAGVKTLVFTVDMPV 160 Serratia sp. S4
WP_009110954  81 TGMYARRGEVQAARAAAQKGIPFTLSTVSVCPIEEVAPAIDRPMWFQLYVLKDRGFMRNALERAQAAGVKTLVFTVDMPV 160 Brenneria
WP_011091762  81 TGMYARRGEVQAARAAAQKGIPFTLSTVSVCPIEEVAPAIDRPMWFQLYVLKDRGFMRSALERAQAAGVKTLVFTVDMPT 160 Pectobacterium ...
WP_004721492  81 TGMYARRGEVQAARAAAKKGIPFTLSTVSVCPIEEVAPAIDRPMWFQLYVLKDRGFMRNALERAKAAGVKTLVFTVDMPV 160 Yersinia ruckeri
WP_013792696 161 PGARYRDAHSGMSGPNAAMRRMLQAFTHPAWAWDVGLMGKPHDLGNISTYRGNPTGLADYIGWLGANFDPSISWKDLEWI 240 Pseudomonas fulva
WP_014037557 161 PGARYRDAHSGMSGPNASLRRIGQAITHPHWAWDVGLFGRPHDLGNISTYRGNPTGLEDYIGWLGSNFDPSISWKDLEWI 240 Stenotrophomonas
WP_015673648 161 PGARYRDAHSGMSGPNAAMRRILQAMTHPQWAWDVGINGKPHDLGNVSAYRGTPTSLEDYIGWLGANFDPSISWKDLEWI 240 Serratia
WP_004959099 161 PGARYRDAHSGMSGPNAAMRRVWQAMTHPQWAWDVGIHGKPHDLGNVSAYRGTPTNLEDYIGWLGANFDPSISWQDLEWI 240 Serratia odorifera
WP_019455688 161 PGARYRDAHSGMSGPNAALRRVLQAFTHPQWAWDVGLLGKPHDLGNVSAYRGKPTSLEDYIGWLGANFDPSISWKDLEWI 240 Serratia
WP_013814335 161 PGARYRDAHSGMSGPNAALRRMLQAFTHPQWAWDVGLRGKPHDLGNVSAYRGQPTSLEDYIGWLGTNFDPSISWKDLEWI 240 Serratia
WP_017893841 161 PGARYRDAHSGMSGPNAAVRRMLQAVTHPQWAWDVGLCGKPHDLGNVSAYRGKPTSLEDYIGWLGTNFDPSISWKDLDWI 240 Serratia sp. S4
WP_009110954 161 PGARYRDAHSGMSGPNASARRLLQAVTHPRWAWDVGLNGKPHDLGNVSAYRGKPTTLEDYIGWLAANFDPSISWQDLAWI 240 Brenneria
WP_011091762 161 PGARYRDAHSGMSGPNAAARRMLQAVTHPQWAWDVGLNGKPHDLGNVSAYRGKPTTLEDYIGWLAANFDPSISWQDLAWI 240 Pectobacterium ...
WP_004721492 161 PGSRYRDAHSGMSGPNAAIRRVLQAMTHPQWAWDVGICGKPHDLGNVSAYRGKPTSLEDYIGWLGNNFDPSISWKDLEWI 240 Yersinia ruckeri
WP_013792696 241 REFWDGPMVIKGILDPEDARDAVKFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGDLKILADSGVRSGLDVVRMIA 320 Pseudomonas fulva
WP_014037557 241 REFWKGPMVIKGILDPDDARDAVKFGADGIVVSNHGGRQLDGVLSTARALPAIADAVQGDLKILADSGIRTGLDVVRMLA 320 Stenotrophomonas
WP_015673648 241 REFWQGPMIIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVLSTARALPAIADAVKGDITILTDSGIRNGLDVVRMIA 320 Serratia
WP_004959099 241 REFWQGPMIIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSTARALPAIADAVKGDIAILTDSGIRNGLDVVRMIA 320 Serratia odorifera
WP_019455688 241 REFWDGPMIIKGILDPEDAKDAVRFGADGIIVSNHGGRQLDGVLSTARAMPAIADAVKGDITLLADSGIRSGLDVVRMIA 320 Serratia
WP_013814335 241 REFWEGPMIIKGILDPEDAKDAVRFGADGIIVSNHGGRQLDGVLSTARALPAIADAVKGEITLLADSGIRSGLDVVRMIA 320 Serratia
WP_017893841 241 REFWQGPMIIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVLSTAHALPAIAEAVKGDITLLADSGIRSGLDVVRMIA 320 Serratia sp. S4
WP_009110954 241 REFWTGPMIIKGILDPEDAREAVKFGADGIVVSNHGGRQLDGVLSTAHALPAIADAVKGDITILADSGIRTGLDVVRMIA 320 Brenneria
WP_011091762 241 REFWKGPMIIKGILDPEDAKEAVRFGADGIVVSNHGGRQLDGVLSTAHALPAIADAVKGDITILADSGIRSGLDVVRMIA 320 Pectobacterium ...
WP_004721492 241 REFWQGPMIIKGILDPEDAKDAVRFGADGIVVSNHGGRQLDGVPSTAHALPAIADAVKGDLKIFADSGIRSGLDVVRMIA 320 Yersinia ruckeri
WP_013792696 321 MGADTVMLGRAFVYALAAAGGAGVSNLLSLIDKEMRVAMVLTGARSIAEISADSLVR 377 Pseudomonas fulva
WP_014037557 321 LGADTVLLGRAFVYALAAQGEAGVANLLDLIAKEMRVAMTLTGARRIADIGRDSLVS 377 Stenotrophomonas
WP_015673648 321 LGADSVLLGRAFVYALAAAGEAGVANLLDLIDKEMRVAMTLTGAKTIGEITRDSLVK 377 Serratia
WP_004959099 321 LGADSVMLGRAFVYALAAAGEAGVANLLSLIDKEMRVAMTLTGAKSIGDITPELLVK 377 Serratia odorifera
WP_019455688 321 LGADSVLLGRAFVYALAAAGEAGVANLLDLIDKEMRVAMTLTGAKTIAEINAGSLVR 377 Serratia
WP_013814335 321 LGADSVLLGRAFVYALAAAGGAGVSNLLELIDKEMRVAMTLTGAKTIADIGAGSLVA 377 Serratia
WP_017893841 321 LGADGVLLGRAFAYALAAAGQSGVANLLELIDKEMRVAMTLIGAKTIADISADSLVQ 377 Serratia sp. S4
WP_009110954 321 LGADGVLLGRAFVYALAAAGEAGVVNLLNLIDKEMRVAMTLTGAKSIAEIGADSLAY 377 Brenneria
WP_011091762 321 LGADGVMLGRAFVYALAAAGEAGVVNLLNLIEKEMRVAMTLTGAKSIADITSDSLVQ 377 Pectobacterium atrosepticum
WP_004721492 321 LGADSVLLGRAFIYALATAGEAGVANLLELFDKEMRVAMTLTGAKSISEIGAGSLVK 377 Yersinia ruckeri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap