Conserved Protein Domain Family
DotM_IcmP_IVB

?
NF033890: DotM_IcmP_IVB 
type IVB secretion system coupling complex protein DotM/IcmP
Statistics
?
PSSM-Id: 411453
Aligned: 70 rows
Threshold Bit Score: 450.83
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_080272350  19 APVWIVILLFITAYFIWALAHQYIVSFVFTINIWQARLVNLFLNN-----------------QLLANQIYLMQTLDp--n 79  Legionella pneu...
OGT52828      14 NFFWLLIILTIGALVFWWLEKSYIVRFIFFIRHYEIDLIQWTISGvnvvtsa----lhlpaiNTSALSYWQQFMITadke 89  Gammaproteobact...
WP_010958339  14 NFFWLLVLLTLGVLVFWWLERSYIVSAIFFVRHYEIDLIKGVLDGvnvglgw----lnltpiDDHKLAFWQHFMATankk 89  Coxiella burnetii
OGT39591      15 NFFWLVALLVGIGVVIWWTESRAVVSFVFWLRIHEIQLIR-WVAelwiptah---flhlpamNLSRLDAIQKYMQTaspk 90  Gammaproteobact...
OGT44068      13 SFFWLLCILFGAAATFWWIDEKYIVIPAFWVRIHEIEVMR-LLAyvwapvad---lfhlpapDFQQLVALQNYMQHvdps 88  Gammaproteobact...
OGT48790      14 NIFWMVVLIFGAAIIFWFVDSRILVIPVFWMRVHEIDAMR-YLAewwipvaq---flhitppDMHQLNALQKYMQTvrps 89  Gammaproteobact...
EKD77140      15 NFFWLIALLFGVGLVIWWVGRQYVVIPFFWVRSFELDLIR-WFSiyagpiah---flhlsvpSIREIDQLQHFMKVadps 90  uncultured bact...
OGT63685      17 NFMWLIGLFFGIAVVVWFVASKYIVIPVFWVRLLQIEFLY-GLEsmwgaiaq---flhmtppDYHDLQALETYLTTvdps 92  Gammaproteobact...
EKD92059      14 NFFWLLVLIFIAAFSIWYFDKRDVVIPFFWLRTHEIDLLR-YLSsiwisatk---nlhlptpDLSRLNQLQYYMQTvnpa 89  uncultured bact...
EKD76973      17 NFFWLIVLIIGSFLVLWWLDKKFVVMPIFWFRYYEIDFLQ-WLATtvwipaatflhlplplpDLHALSSLKNFIGTtdpa 95  uncultured bact...
WP_080272350  80 TVNWDQMVTVMRAVGDYMRYPVICILVVLAFVLYNSNVTLKYRKTYDMKSLRAQEQFNWPAIMPIIKEDLVSQDVNKGPW 159 Legionella pneu...
OGT52828      90 KILFPQVTSLSDAVGLWLRYPVMLVLLILAAYLFFHNRSTRFRQIYTMQSLRKLESENWPQITPVLSLDLVKQNLKEGPW 169 Gammaproteobact...
WP_010958339  90 EVTFPQVGALSTDVGLWVRYPVILILLGLASWMLFRNRSARFQRTHTMDSLKKSEVENWPQITPVLSLNLLKTDLDKGPW 169 Coxiella burnetii
OGT39591      91 AVTWNMFAAINAEIGQWMRYPTIIILLSIAIVVGFR-ATSQFRHTYNMKTLRVVDQEVWPQITPVLSLDLVKENINQGPW 169 Gammaproteobact...
OGT44068      89 QVSWTKFSAINAALGEWTRYPIILIFIGLAAVVYFR-GGSQFHHNYNMKTLRVVGQEVWPQITPIISLDLVKEDIDKGPW 167 Gammaproteobact...
OGT48790      90 SVTWTNFSAINADLGEWTRYPIVIIFVMLAAFVFFR-GAAQFRHDYDMKSLRMVGQEVWPQIIPVLSLDLVKENIDKGPW 168 Gammaproteobact...
EKD77140      91 KMDWKNFSMVNVSIGAWTKFPIGIIFLLLAAFLAWR-GTGQFQHIYSMKSLRQIGQAVWPEITPVISLDLVKENIDKGPW 169 uncultured bact...
OGT63685      93 TVDWRKFASINKEVGEWTRFPVIFVLLGLSAVAWSR-TGAQFRNSYSMKQLREVGKEAWPQIAPVLSLDLIKADIDKGPW 171 Gammaproteobact...
EKD92059      90 TVSWKEFSRINLEIGRVTRYPIILILIMMAVFMFFRFGVAGLHTLYNMKTLRDFDQPEWPQITPVVSLDLIKEDISKGPW 169 uncultured bact...
EKD76973      96 HATWKNFATINVLIGHWTRYLVMSILLILSAASYFR-SGAHFHHTYSMKTLRVVNEEMWPQIRPIADINLMKEDIDEGVW 174 uncultured bact...
WP_080272350 160 AMALTPMEFARKYNLLRKDdALLDNPVpgqemtAGIRRGDAKRVFTMQLGPYWDGFERCSPQAYALSAVFMARMNRDRDA 239 Legionella pneu...
OGT52828     170 AMAKLPLDFCKQHDLLKISqGERGEKI------WQLRSKEVERLFVLQMGPLWQGAEALPIHVKALLVIFLTRAHRDHDV 243 Gammaproteobact...
WP_010958339 170 AMAKLPLNFCKEHNLLDIPiGENDKKV------WTVKPGPAERLFVLQMGPLWKGVEALPIHVKALLIVFVARGHRDHKV 243 Coxiella burnetii
OGT39591     170 AMSKAPLDFCREHDLLSLK-TIAGKKV------YFLKQKPSYRLFALQLGPMWKGIDFLPIHIKALAVIFLARATGQRPI 242 Gammaproteobact...
OGT44068     168 AMCKLPLDFCRTHDLLLMK-VVAGKKV------WTMKQKPAYRLFALQLGPMWKGLEFLPIHLKALAVVCLARATNQRPI 240 Gammaproteobact...
OGT48790     169 AMCQLPLDFCHQHELLLMK-VVNAKRV------WTLKQKPAYRLFALQLGPMWKGLKTLPIHIKAIALICLARATGQRPL 241 Gammaproteobact...
EKD77140     170 AMAQLPLDFCRQHELLSVK-TVAGKKI------WALKQKPAYRLFTLQLGPMWKGLDVLPIHIKALVFIFLARATGQRPA 242 uncultured bact...
OGT63685     172 AMARPTLSFCRENDLLSVK-VVAYKKV------WVLKQRPSYRLFALQVGPLWMGLEALPIHLKMLVLVFLARATGQRDI 244 Gammaproteobact...
EKD92059     170 AMAKLPIEFCREYDLLLLK-AVNKKQV------WTLKHKTAYRAFVVQLGLLWTGIDNLPIHIQALIVIFMARVTGQRPL 242 uncultured bact...
EKD76973     175 AMARTPLLFCKEHNLLSVT-TTAGKKV------WVVNQKASYRLITLQVGSLWTGLDALPIHVKAIALIFLARAMSQRPL 247 uncultured bact...
WP_080272350 240 ANNILKVLDKTFVDGKpDFSVARPVMKKYQNTELVQEVVAKHAYVLTVIASLLEAAREDGVVPSSEFLWLKPVDRRLWYM 319 Legionella pneu...
OGT52828     244 AEKLLEQISESASHGKlDFSGVEEYLQKYQHSKIIPWLEKRHAYVGTFMASLLEIARTDGVLATAEFLWLKPVDRRLWFM 323 Gammaproteobact...
WP_010958339 244 AEDLLVQIAQSALHGRlNFSGVEELLTKYKDSKIIKWLESRHAYVGTLMASLLEIARIEGVLATAEFLWLKPVDRRLWYM 323 Coxiella burnetii
OGT39591     243 ANALLKQISASASSGKlDFTGVSDQLKKFKDHRIVKWLEKRHSYMTTLMASLLEISRSDGVLASAEFLWLKPVDRRMWYV 322 Gammaproteobact...
OGT44068     241 AKAILSQVAISAASGKlDFTGVSDHLKQFKDHKIVNWLDRRHAYVTTWMATLLQVARSDGVLASSEFLWLKPVDRRMWFM 320 Gammaproteobact...
OGT48790     242 AKTFLSQIAASAASGKlDFTGVSEQLQQFHNHRIIQWLQLRHAYVATVMATLLEIARSDGVLASAEFLWLKPVDRRMWFM 321 Gammaproteobact...
EKD77140     243 ANALLRQIAASAATGKlDFTGVSEQIKTFQNHRIVKWVEKRHAYMATFMATLLEIARSDGVLASAEFLWLKPVDRRLWFV 322 uncultured bact...
OGT63685     245 ARRFLSQVSASAASGKlDFTDVSEQLKSFYGHRIIRWAEKRHAYVTGVLATLLEIARSDGVLASAEFLWLKPVDRRMWFM 324 Gammaproteobact...
EKD92059     243 AKKILSQIALSAATGKlDFTGVSEAIKQFDSHRFIRWLEARHAYVTTLMATLLEISRSDGVLASAEFLWLKPVDRRLWYV 322 uncultured bact...
EKD76973     248 SNRIIVQLAASASSGQlDFSTISDELKKFYKTPVITFLEKRHAYVLTFMASLLEIARGDGVLGCAEFLWLKAVDRRLWYM 327 uncultured bact...
WP_080272350 320 LNCVGRQTPYSEVAGPFAHWKAEKEMGRRSLVPMIDEAIRALEIAVKEVKLSP 372 Legionella pneumophila
OGT52828     324 LNSVGRQTAVVEVAGLFAHWLTEKKLKRHLRTPMVKEAVNALEEGVKDILYVA 376 Gammaproteobacteria bacterium RIFCSPHIGHO2...
WP_010958339 324 LNSVGRQTAVVEVAGLFAHWRAEKRLERPLRTPMVKEAVTALEKDITTVLYIS 376 Coxiella burnetii
OGT39591     323 LNNVGRRTAFVEVAGAYSHWVAEKKVGRALKTPMVKGAVDALDETLQNILFVE 375 Gammaproteobacteria bacterium RIFCSPHIGHO2...
OGT44068     321 LNNVGRRTSFIEVAGAYSHWKAEQKVGRALKTPMVKGAVDALDEALQNVLYVE 373 Gammaproteobacteria bacterium RIFCSPHIGHO2...
OGT48790     322 LNNVGRRTAFVEVGGAFAHWKAEQKIGRALKTPMVKSAVDALDETLQNVLFVD 374 Gammaproteobacteria bacterium RIFCSPHIGHO2...
EKD77140     323 LNSVGRRTSVVEVAGVFAHWKAEKKLGRMLKTPIVKGAVDALEEALQNILLIE 375 uncultured bacterium
OGT63685     325 LNSVGRQTAVVEVSGAFSHWIAEKKLERAIKTPIVKGAVDALDEALQSILYVE 377 Gammaproteobacteria bacterium RIFCSPHIGHO2...
EKD92059     323 LNSVGRRTATVEIAGVFSHWQAEKRIGRALKTPMIKNAVDALDESLQNILYVD 375 uncultured bacterium
EKD76973     328 LSNVGRPASFVEVAGAYSHWQAEKKIGRALKTPIVKGAVDALTESLQNILYVD 380 uncultured bacterium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap