Conserved Protein Domain Family
conj_TraO_IncI1

?
NF033884: conj_TraO_IncI1 
conjugal transfer protein TraO
TraO, involved in the conjugal transfer of plasmids such as IncI1 plasmids, shares homology with IcmE of type IVB secretion systems.
Statistics
?
PSSM-Id: 411447
Aligned: 15 rows
Threshold Bit Score: 402.097
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_001272004     16 ALLGLSSIILFGGSYIAFSKVSgsNSDMQSAVNINSAASGGTRSVTETPHYRELLRADNERGAAAAARNKQTFIASLPQG 95  Escherichia ...
1_ncbifamImport   1 ALVGGALVVVFGGAYYLWDWLAr-PEPAQSKVDLGRVAQASRSHSTESPAYRDLLKQYNEEGASTAKNENSSFIASMPME 79 
WP_000021265     16 ALVAVAVLIVAGAGYVGWGWMHq-SAVPESQYNLNRVANNATVSAQESRQYRELLRLANQQGAQEAENDGNSFVASLSES 94  Salmonella e...
WP_000963756     16 AIIGAAAVCVLGGAYLGWGYLSr-SEEPESQYNLKRVASSTPVTSQESQQYRQLLSQANRMGARQAEQEGDSFLATLSTG 94  Escherichia ...
WP_017374624     16 MVIGGLAITLLVGGYLAISWLNk-PPPSPSRISVNRAAGGTGSEAPESLQYRQLLKESNEEGARQALETNASFIASVSMA 94  Enterobacter...
WP_004720823     16 IIIATVIFSLIAGGFLLVSWISt-PPPPASRINVDKTAGGSGKIAAESPQYREILRENNAEGAKQAQAANTSFIASVGSG 94  Yersinia ruc...
WP_015873082     16 ILLMICIVVLAVLIYLILQWTDt-PIETKSIVQIDSVASQTGRPTKESAEYRALLEKYNRTESEKAREEGQSFVARIREG 94  Candidatus H...
WP_013036415     17 GLIALGAGVLTGGGYLLWTWLAa-PPPAPSSIDMNNLGAMAQNNAQEQQAYRDLIRENNARGAHNASANNQTFLGSIPLE 95  Erwinia amyl...
WP_004206932     15 YVGGAAAVVALLGGYWLFGSSDe-PATGGSQVKAQGLEGKTGREKANDPQYNKLLNEWNADNSEKAALTGDSFISTLSAS 93  Enterobacter...
WP_007183099     13 IVAIGVIVTIAVVGYIAATYFAd--SSRKQSQISAVQTQGRGTPTKESEQYSQVLDKYNRTKATDAEQNGQSYLSVLSSR 90  Burkholderia...
WP_001272004     96 LDI-PDT---PEKQQQPAAKPENYAYRQASGTPQEDRAA--SEKRMERLQKLIVRIKDQHPAGS-TPTIATTMWNKS--- 165 Escherichia ...
1_ncbifamImport  80 QTS-VMLpvtKAKPAPQAEPTARRSHTRQDENSKDSEKK--EDPRLKALLERINPEKKAEERQSgLVFAHVLGGTNAlng 156
WP_000021265     95 SQH-DDVpvvPRVQATPVALDTRNGTAPQDTGQQGGLNDe-QKQQITNLLTQLNARWQTSDMQLaSAFGSEGQ-DGAspf 171 Salmonella e...
WP_000963756     95 NPE-PETpppP---QQDVQLQTTPPAGTGNEQRTGGTSDg-KRQQIQAFLAKLDQRWAPGEMTLaATFDGNAQGNSGehf 169 Escherichia ...
WP_017374624     95 PQP-EPLeiaTVPVPEP---TPVQHIQQVQYVSAPGLAAd-QKKAVESYLSELIAQRAPSTGKSaGIAGGAVV-QGAgsa 168 Enterobacter...
WP_004720823     95 TVR-QVPpisQVPLPAPQTPTPSGYSQQSQ-PAPTGIDPd-RKKALEAMLKELVIQRAAPAGQIaSITGMTGG-QAGgnp 170 Yersinia ruc...
WP_015873082     95 TEEnQKPspaSLPDENRYAPPPVTEQEKGSAFTETGANEh-RRKAIDTLLQELNAQWQPVAFQLaPLIEGGEAVSEG--- 170 Candidatus H...
WP_013036415     96 QDV-IKPvevKAKPPQDKPKDILPPQTRGSGRTQEQEKAl-AEARQKALAALLAKMQQPPE-TEeLPEAKLLGGKDSs-- 170 Erwinia amyl...
WP_004206932     94 NPVaVDYgtkAPPPKYSWESSAKPSGDNSKANDAEQKERerQAKAVATLLQKIDQARTPVVTGVaLATSLGAEGNDKngg 173 Enterobacter...
WP_007183099     91 TNNvPDQp-aSAPQAQPQAQ-QVVYYQQPAQQQNPQ-QDqqRQKEVSDQMQGLMANWAPVPHSTaR----VSTDSADyak 163 Burkholderia...
WP_001272004    166 ----PAETTGQNGTQQFALQNAs---------LSTPVAEKGIQLIPALTRIPAYIDTAVDSDNPSSKVIATIPaGPWAGA 232 Escherichia ...
1_ncbifamImport 157 sgdtNTGSAGGYDSWSETLPGGaklk--tasmKSTAEPYSPVEVVPPYWRGAGVIDIGVDSDNSTTPVLGKLS-GPYAGA 233
WP_000021265    172 sqwaQSVPGLASPPPQPAAQTTa--------gGSTSG-TTSRINIPGLSRYPGTIDTAIDSDNPESKVLAIIPaGKLAGA 242 Salmonella e...
WP_000963756    170 sqwaAGVPGLQTVSQTTASQRTa--------gKPDSTPVTASFSIPGLSRYPGTMETSVDSDNAGSVVLASIPaGKLRGA 241 Escherichia ...
WP_017374624    169 -sgqTTAWSNWTDSFNPALPTPv--------tT-PTVTNHDVVLIPAGSRSGGVIETAIDSDNPRSQVLARIPaGPYAGA 238 Enterobacter...
WP_004720823    171 ggtpVSVYASWTESLAPTLTSAt--------lSGSTSRNTDNVVIPAGSRPGGVIDTAVDSDNTNSQVLAHIPaGPYAGA 242 Yersinia ruc...
WP_015873082    171 -----TWTDSVAQQSTAPLPLTg-------------NDITEKAIVAPYTRVPAVIETAVDSDNPDSQVLAKIPtGAYAGA 232 Candidatus H...
WP_013036415    171 -----------WAAWRDSLPGSevqlaaarsrQNTLNAPPASVVVEPYWRGPGEICTGVDSDNGATPVLGCIKtGPYAGA 239 Erwinia amyl...
WP_004206932    174 tfsgWTDSVYPQNKKPDAEKQQg---------AKNKVKDKGARLVSAYTLVPAVMDTAMDSDDQNSIAIAHVPtGAQAGA 244 Enterobacter...
WP_007183099    164 --slMHESDTPAQVQQAAAAAAa-----------------kVKVVEDFALIPAMLQTAIDTDE-NSVVRAYIPnGQYAGA 223 Burkholderia...
WP_001272004    233 TLFSPG-VKLVGNGVEIHFDRMSWNGMDLKVNAYAQREDNLMSSVASNVNTRWFKHIILPSVLGGVGSIGTLYKDANTQ- 310 Escherichia ...
1_ncbifamImport 234 VLKAPEgARLAGDGVVIHFTEMAFNGVNYKVDAYALQDDTLLANVASEVNHRYMSRIVLPAVLGGIGNISDMYSQANTQ- 312
WP_000021265    243 TLAAPN-VQLAGDGVIVNFKTLAFNGMTCTIDAYAQDDETQRSSIASSVNHRYVTRIILPALANGLGKVGQLYEDSNTQ- 320 Salmonella e...
WP_000963756    242 VLSARG-VQLAGDGVVIHFTTMQYAGQTCTIDAYALDDETQRSSVASNINHRYFSRIILPALANGIGKVGQLYEDSNTQ- 319 Escherichia ...
WP_017374624    239 TLLANG-VQIAGDGVSINFNRMEWNGDVWNVDVWAAMPDTLQSSVATSVNNRYLTRIVLPALAGGVGLGGQLYASANTQ- 316 Enterobacter...
WP_004720823    243 TLMANG-VQLAGDGVNIHFTKMTWNKDTWRIDVWAAMPDTLQSSVASSVNNRYGTRILLPALAHGLGLGGQLYASANTQ- 320 Yersinia ruc...
WP_015873082    233 QLQAKR-VQLVGDGLSIHFERMSWRGQTYAVEAYALDEKTLQSSVASTVNHRYFSRIILPAVAMGMGRAGQLFEQANTQn 311 Candidatus H...
WP_013036415    240 VLKAPEgAKLSGNGVIIHFTTMTLNSKAYKIDAYGLDDKTLVANIASDVDHHYGRRILLPAFLKGIGATGELYAQSNTQ- 318 Erwinia amyl...
WP_004206932    245 KFYSGQ-NRLAGDGIRIHFTGMELNGVQCKVDAYGVASDSLRAAVSSNVNNRWFSRIILPAVANGLGRTGQLYADSNSQ- 322 Enterobacter...
WP_007183099    224 VLFAMG-YKRITNSVDMTFSYMQWQGHSYKVTAKAMDQTTMRTALSGDVNNRYFSRIIIPAIAMGIGRTGQLFEQAAAQn 302 Burkholderia...
WP_001272004    311 VIQGNYGTVTGRVGMPSGEAVAGVIAGGMAERGSQILTRQAESEPYKQVEVYQHEVVSILFVDPVMTNDARSSSL 385 Escherichia coli
1_ncbifamImport 313 VLSNGFSTQTARPGMPDGTAVAGTILGGAAGQAAKVLTEDAARTPATQVNVFKGQVVAIQFMRGVYAGDAVAPGR 387
WP_000021265    321 ILTTNSGTVTGRTGSPDSKAVAGVIAGGIGQQTAQVMTQDASRLPVTQANVDRRQVVSILFMKPVTDKDCTPTPA 395 Salmonella enterica
WP_000963756    320 ILTTNSGTVTGRTGTPDGKAVAGVIAGGIGQQTAQVMTQDAARLPPTQAVVDRKQVVSILFMKPVSDKDCLPSST 394 Escherichia coli
WP_017374624    317 ILSNGYNNIEGRVGMPDSKAVAGTIIGGAAQQAGQVIASDAQRLPVKQVLVERGQTVALLFMSAVKSGDSITRAS 391 Enterobacteriacea...
WP_004720823    321 ILSNGYNTLEGRVGMPNGTAVAGTVLGGAAQQAGQVIASDAQKLPVKQVLVDRGQSVALLFMTAVKESDKETTTT 395 Yersinia ruckeri
WP_015873082    312 TITPQGTVIQTRASNPDGRAIAGTIVGGIGQQAAQVMTHDAARLPIQQVTLHRGQIIAIQFMGGVYEKDNLRLKS 386 Candidatus Hamilt...
WP_013036415    319 VLTNGFNTVTARPSAPDGSAVAGVIVGGAAEQAAQVLTNDAGRLADRTVTVDYGKVVAIQFMSGVYSTDAEAP-Q 392 Erwinia amylovora
WP_004206932    323 MIITDGGNAYRSTGTPDGKAVAGTIIGGMGEQAGRVLADDAARLPVKQVTVDRNQLIGIQFVAPVYESDCGENME 397 Enterobacterales
WP_007183099    303 IITPQGGVIQTYPSTPSWSAVGGTIAGGMGQQAGQVLANDAANMPVKQVLIPKDTPIWIQFIGPVLASDDVAAGA 377 Burkholderiaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap