Conserved Protein Domain Family
conj_TraQ_IncI1

?
NF033883: conj_TraQ_IncI1 
conjugal transfer protein TraQ
Statistics
?
PSSM-Id: 411446
Aligned: 16 rows
Threshold Bit Score: 202.886
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_001388619   4 DALTAIENFASGIFSAGMEFLFTWGELLGIIGLIGHLMRARAEG----RHSMGPGKFIAGIFICGMLVSLPSMINAGGTQ 79  Enterobacteriaceae
WP_014640318   5 DALTAIENFASSIFSAGMDFLFTWGEFIGVISMITLFARARSAG----PVKMSPGKFIAGMLTSCMLVSLPAMINAGGVQ 80  Escherichia coli
WP_001090608   4 DALTAIEHFANGIFSAGMDFLFTWGEFLGVIGLIAHLARSRVDG----PARMTPGKFIGGLFTCAMLVSLPSIINAGGIQ 79  Salmonella ente...
WP_019842546   4 DALSAIISFGNNIYSSGLSFLVSWSTFVGVAGFALVLASAHSRGn--rGGQVYTGKTLLSLFFCAGLTCLKPLVNASGAQ 81  Enterobacteriaceae
WP_004187478   2 DLESVLIQVANGGQEPLTRLIIGVAAIVGIIGVIGYLMSLRKQArh-sTKGVEVGRIFAGIIFCVCLITLKAQMNSGGAT 80  Enterobacterales
WP_004131808   2 DAVQALVKFASGLHASIFNLVWAMATLLAIIGSATFLTAQVRQArl--pHGSGGGKIVAWILLCAGLVGLQQMISAGAAQ 79  Klebsiella mich...
WP_000348307   2 DFVQMLANATNNLSAITTQLVLAIAGVGGIALIILYLSGQAG-RtrrgQRTDSGGTFLAVLLLTCCIISLESVVNAGSNQ 80  Enterobacteriaceae
WP_015873080   4 DLIQMLGHLANTLTKSGINLVMSLSVVMGIFSATVYCVRLARPKthrqGGGFSLGKGVLFLMMCGGLISLRQIMNASSHQ 83  Candidatus Hami...
WP_017374622   2 DVVQILVNLADGLKTSGINMILSLAFFFGLGSCIVALLSAIKrg--rtGRPANGIKTVAAVCMGGALMSLQQVMNKAAHS 79  Enterobacteriac...
WP_009682438   2 DLASMIISAANSLVAVLWGLLWSLSALAGMVYAGTVLRRMQLATiepgHRPITLGSTFAVLVIGAALFNMSGMISTTWTS 81  Pseudomonas
WP_001388619  80 MGFRADSFAPIAYVQPGSFGAAAGAVNAILSLAKLAGVGFVMNGISIWRKSLLDGHTALSASESISKGNVKFVAGVLLVF 159 Enterobacteriaceae
WP_014640318  81 MGFRADSFGPIAYVQPQTFGAAAGAANAVLSLAKLAGVGFVMNGISIWRKAGLDGHTALSASESVSKGNVKFIAGVLLVF 160 Escherichia coli
WP_001090608  80 MGFHADSFGPIAYVQPQSFGAAAGAANAVLSLAKLAGVGFVMSGISIWRKAGLDGHTSLSASETISKGNVKFIAGVLLVF 159 Salmonella ente...
WP_019842546  82 FGFEMTSFDSISWAPTSTFGQGAEAVNALLTVARLFGIGCFMGGLNTLRRSGLEGHTALSASENTSLGFGKIIFGTLLAF 161 Enterobacteriaceae
WP_004187478  81 LGFGDVSFGPVSYASESTFGMGAAAVNAVLGIVRILGAYFFYRGIKGLKDSYLEGHTELSASGTRGASIVKIVCGLLLMF 160 Enterobacterales
WP_004131808  80 MGWNSVSFDAVAYVSTASFGAGAEAANAVLTLVRALGGVFCLNGWLLFRRSLKDGHTGLTAGQDVAGGWVRFICGVLMIC 159 Klebsiella mich...
WP_000348307  81 FALGAVTFDAISYVPEARYGPAAVAVNAGLTALQSIGWIFALNGLLRLRRSQKDGHTGLTRGDDISSGIKRFICGVLLVC 160 Enterobacteriaceae
WP_015873080  84 LGFGDVTFDAIAYVSPSRYGPAAEALNAVLTLLRLLGVIFFYQGIRRMKRSLIDGHTGLSAGEDVSHGVVKVLIGTLLIC 163 Candidatus Hami...
WP_017374622  80 LNFNDVSLDAISYAPDS-LGYAKLSIDAVLTLLKAIGFLFCYIGFQRARRSLVEGHTGLSAREDIGKGAVMFICGVLLAC 158 Enterobacteriac...
WP_009682438  82 FGSGSTTYGAISYSGADSFGRFKDAVNAVLTLASFAGGCFFFKGLLLMKKAALEGESSQGGDDAIWRGLTHMIFGAALTH 161 Pseudomonas
WP_001388619 160 NDRVIDATLASLGIA 174 Enterobacteriaceae
WP_014640318 161 IDRVLNALLASIGIV 175 Escherichia coli
WP_001090608 160 IDRVLDALLASIGLA 174 Salmonella enterica
WP_019842546 162 IDNVLDATLTSLNIH 176 Enterobacteriaceae
WP_004187478 161 DTQTLDALQSTLNIH 175 Enterobacterales
WP_004131808 160 NPYLLDALQASLGLA 174 Klebsiella michiganensis
WP_000348307 161 NPSVLSALQNTINIH 175 Enterobacteriaceae
WP_015873080 164 NPYFLTALKNTLNIV 178 Candidatus Hamiltonella defensa
WP_017374622 159 NTQLLDALQTTLGLT 173 Enterobacteriaceae bacterium LSJC7
WP_009682438 162 VDKVIEAFQATFQLY 176 Pseudomonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap