Conserved Protein Domain Family
T4SS_lipo_DotD

?
NF033882: T4SS_lipo_DotD 
type IVB secretion system lipoprotein DotD
Members of this family are the lipoprotein DotD from type IVB secretion systems, which are also called Dot/Icm secretion systems. DotD is is related to conjugal transfer protein TraH as that term is used in IncI1 plasmid transfer regions.
Statistics
?
PSSM-Id: 411445
Aligned: 65 rows
Threshold Bit Score: 178.873
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PHQ80765  17 LAGCsdskrvVdlhlNYVTADktPVLAFdrqAQAQVAEAATASSGSLEELSAIDMAnSTPKAQNSIkqPWNAAAIGMTGL 96  Coxiella sp. (in: B...
OAI49487  18 LNAC------------STTPPqmSNLDSs---dHSLAEASFAVSRSISSLSETAQA-AHPFSRLEP--PPNPASYDMAQL 79  Gammaproteobacteria...
OGT47942  15 IGAC-----------STPTKP--PEHPLg-kHEASLAEASYAVSRSIVSLAETAQA-AHPLPNLAP--PPSPATYDMDQL 77  Gammaproteobacteria...
OGT60084  16 LCAC-----------ANPPPP--QIFNVs-kTENSLAEASYSVSRSVVDLAETAQA-AHPMPDVAP--PPNPASYGMAGL 78  Gammaproteobacteria...
RDI41690  16 LYAC-----------ATPKPQ--QSYNVs-nTEASLAEASYSVSRSMVDLAETAQA-AHPLPPLAP--PPNPASYGMAGL 78  Aquicella lusitana
OGT37353  14 LSAC-----------ASPQPP--YPQDTn-rTTISLAEASYSVSRSIVDLAETAQA-AHPLPSLAP--PPSPATYDMAGL 76  Gammaproteobacteria...
OGT38567  15 LYAC-----------ASPTPP--KGFDIt-kNEASLAEASYSVSRSVVDLAETAQA-AHPLPSLAP--PPSPATYGMAGL 77  Gammaproteobacteria...
OGT54486  14 LFAC-----------AIPKTP--SGYDLs-qPQNSLAEASYSVSRATSDLAETAQA-AHPLPPYSA--PPSPASYGMGGV 76  Gammaproteobacteria...
OGT31786  13 LSAC-----------AKSPPP---VPSTtenASLALAEAANSVNSSLIQLDATEQA-ANPPLSIAT--PPSPASYGMAIP 75  Gammaproteobacteria...
OGT22780  16 LTACs----tQs---SYPSPN-----SSdydAYMALGEAATSVNQSLTTLGKTEQA-AYPPVRVSE--PPNPASYGMSMP 80  Gammaproteobacteria...
PHQ80765  97 ASIDWNGPVLPILKKIAAASNYRVRVLGTPPPIPVLVLVNAENQPLADILRNVMYQVHNKATIKVYPHTKVLELRYF 173 Coxiella sp. (in: Bact...
OAI49487  80 ISIDWSGPIEPLVRQLAQVARYRVRVLGRPPAIPVLVSVYDKNMMLADVLRDVGYQAGRRACLVVFPDSRVIELRYA 156 Gammaproteobacteria ba...
OGT47942  78 TTVDWSGPVEPLVRQVARAANYRTQVLGTQPAIPVLVTIYTKNQMLGDVLRDIGYQCGRRATVVVYPGSRTVELRYA 154 Gammaproteobacteria ba...
OGT60084  79 TTVDWSGPVEPLVRQVAKASNYRVRVLGTQPAIPVIVTLYEKNAMLGDVLRDIGYQCGRRAAVVVYAESRVIELRYA 155 Gammaproteobacteria ba...
RDI41690  79 TTVDWSGPIEPLIRQIARASDYRVRVLGTPPAIPVIVTVYAKNAMLGDILRDVGYQAGRRATVTVFPESRVIELRYA 155 Aquicella lusitana
OGT37353  77 ASIDWSGPVEPLIKQIAKAADYRVRVLGTRPAIPIIVTVYVKNAMLGDILRDVGYQCGRRASVVVFPGSRVIELRYA 153 Gammaproteobacteria ba...
OGT38567  78 TTVDWSGPVEPLVKQIAYAANYRVRVLGTAPAIPLLVTIYSKNTMLGDILRDVGYQCGRRGSVTVFPESRVIELRYA 154 Gammaproteobacteria ba...
OGT54486  77 TSVDWSGPVEPLLQQIARAGNYRVRVLGTPPAIPILVTVYANRVMLADVLRDTGYQCGKRASIIVFPETRVIELRYA 153 Gammaproteobacteria ba...
OGT31786  76 ASLDWTGPAEQAITEIANAANYKLSILGPEPSMPIIVSVHQHNSTLGDILRNIGLQCGHRAQVVIYPKTKTIELRYI 152 Gammaproteobacteria ba...
OGT22780  81 ASMDWNGPIQPLIQQIANSANYKLRVLGRAPAIPIIVSITAKNTPIGDILRDAGYQSGKRANIVVFPSTHTIELRYA 157 Gammaproteobacteria ba...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap