Conserved Protein Domain Family
SidJ_poly_Glu

?
NF033873: SidJ_poly_Glu 
SidJ family T4SS effector polyglutamylation protein
SidJ, called a pseudokinase because its polyglutamylation activity differs from what might be expected from its kinase-like fold, is the founding member of a family of such pseudokinases. SidJ itself, as described in Legionella pneumophila, is exported by a type IV secretion system (T4SS), and modifies and modulates the activity of T4SS effector SidE.
Statistics
?
PSSM-Id: 411437
Aligned: 7 rows
Threshold Bit Score: 1410.38
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_058464857  91 TGGKFRFASMGETDTHDNSLLPASKFVSGRSIPLKEIPFETTRSELVQIYLLSLDKCIKANKLKELAPQALAGHYLLIKS 170 Legionella cinc...
WP_011216062  98 HVKQYYFARRGETSTHDTSLPPPVKVLSGRSIPLKEIPFEATRNELVQIYLISIDQLIKSNKVSSVPPQQLASHYLFLRS 177 Legionella pneu...
WP_128130275  92 TVRKFRFARMGETDTHDKSLLPASKFVSGRSISLKEIPFETTRSELIQIYLLSISQCIKANKLKELSPQALAGHYLLIKS 171 Legionella sain...
WP_003634608  89 TVRKFRFASLGEIDTHDKFLLPATKFISGRSIPLKEIPFETTRNELIQIYLLSLNKCIKENKLREIPPQVLAGHYLLIKS 168 Legionella long...
WP_058499657 101 PVGHYRFAKIGETDTHDKSLLPAFKMVSGRPIRLNEIPFETTRSELIQIYVLSVDKCIRANKLKEISPQALAGHYLLLKS 180 Legionella grat...
WP_027222619  35 PLKQEYFVKTGESETQDLGLLPVVSKRHNQSVPLEEIPFEDTRLELIELYIALLKQCVLDEKLKSIPAQYLISHYLFLKT 114 Legionella pneu...
WP_021437194  35 PLKQEYFVKIGESETQDLGLLPVVSKRHNQSVPLEEIPFEETRLELIGLYITLLKQCVLDEKLKSIPAQYLISHYLFIKT 114 Legionella pneu...
WP_058464857 171 LAAAAQNLPEKNQLLALEKPFVNYLKGKESSIWSIVNDYTRDSEFPIVQWLKNQSSNSNFMVSFIIESNKGTLTRNQNAF 250 Legionella cinc...
WP_011216062 178 LANSENDGIKKNQILSLAKPLGTYLASKEPHVWKMINELIEKSEYPIIHYLKNNRAHSNFMLALIHEHHKGSLNKNQSAF 257 Legionella pneu...
WP_128130275 172 LAAVAQNLTEKSQLLALEKPLGNYLKSKESTTWSIVNDYTRDSEFPIVQWLKNQSSNSNFMVSFIIDNNKGTLTRNQNAF 251 Legionella sain...
WP_003634608 169 LAAVAQGPTEKSQLLVLEKSFGNYLKSKELSIWSIVNDYTRDSEFPIVQWLKNQSSNTNFLVSFIIDNNKGTLTRNQNAF 248 Legionella long...
WP_058499657 181 LAAVAQSQTEKSHLVVLEQLFASYLKSKEPSIWSRINEYTRESEFPIVQWLKNQSTNSNFMVSFIIDSNKGTLTRNQNAF 260 Legionella grat...
WP_027222619 115 LAANERNKGRKDLYLNLSQKVADYLEKNESKIWSMAVECTKTSEYPIVSWIKNHQIHFNFIRAFILDNNKKPLTHNQRAF 194 Legionella pneu...
WP_021437194 115 LAANEGNKGRKDLYLNLAQKVADYLEKNESKIWSMAVECTKTSEYPIVDWIKKHHLHFNFIRAFILDYNKKPLTHNQRAF 194 Legionella pneu...
WP_058464857 251 IQQFKDSPAFFLPNPIYMSWLTHSYEKDSSINPMYNISKKTHYYHATIADNLLLRTQPKQVTFAPKHYYEKGKGIVDTDF 330 Legionella cinc...
WP_011216062 258 IQKFRDSSVFLFPNPIYTAWLAHSYDEDSSFNPMFRERLSTNFYHSTLADNLLLRTEPKEVTLSSEHHYKKEKGPIDSSL 337 Legionella pneu...
WP_128130275 252 IQQFKDSPAFFFPNPIYMSWITHGYEKDSNINPMYNISKKTHYYHATITDNLLLRTQPKQVTFAPKHYYEKGKGTVDTDF 331 Legionella sain...
WP_003634608 249 IQQFKDSPAFLFPNPIYMSWVAHGYEKDSNINPMYNISKKTHYYHATITDNLLMRTQPKQVTFAPKHYYENGKGIVDTDF 328 Legionella long...
WP_058499657 261 IQQFKDSPAFFFPNPIYMSWLTHSYEEDSSLNPMYNISKKTHYYHATITDNLLLRTQPKQVTFRPEHYYQEGKGIVDTDF 340 Legionella grat...
WP_027222619 195 MQQFSDSAAFFFPNQVYLAWLTQSYEPDSILNPMYRESRSTHYYHANITDNLLLRTRPKQVNLGAQHFFQKGKGSVKNTF 274 Legionella pneu...
WP_021437194 195 MQQFRDSAAFFFPDQVYLAWLTQSYESGSILNPMYRESRSTHYYHANITDNLLLRTRPKQVNLGPQHFFQKGKGSVKNTY 274 Legionella pneu...
WP_058464857 331 RYTMDPSNFLRIQGRTLLF-TDESEELIAVKVQKKGEPKSNLTEEFQMADYLQKHQNRLDLQSQLPRPLGQYSVKRTEIL 409 Legionella cinc...
WP_011216062 338 RYQMSSDRLLRIQGRTLLF-SNPPNEVVAVKVQKKGEPKSTLEEEYQMADYLLKHQRRLDLQSELPQPLGQYSVKKSEIL 416 Legionella pneu...
WP_128130275 332 RYTMHQSNLLRIQGRTLLF-TDDSEELIAVKVQKKGEPKANLTEEFQMADYLQKHKNRLDLQSQLPSPLGQYSVKRTEIL 410 Legionella sain...
WP_003634608 329 RYTMHQNNLLRIQGRTLLF-SDESGELIAVKVQKKGEPKNNLTEEFQMADYLQKHQNRLDLQSQLPTPLGQYSVKRTEIL 407 Legionella long...
WP_058499657 341 RYMMNQSNLLRIQGRTLLF-TDESGELIAVKVQKKGEPKSSLTEEFQMADYLRKHQNRLDLQSQLPKPLGQYSVKRSEIL 419 Legionella grat...
WP_027222619 275 RFNMNDGKLLRIQGRTLLFsTNKGNEIIAVKVQKKGEPQSALSSEFQMADYLLKHQRRLNLQSQLPIPLSQYSINRAEVL 354 Legionella pneu...
WP_021437194 275 RFNINDGKLMRIQGRTLLFsTNKGNEVIAVKVQKKGEPQSALSNEFQMADYLLKHQRRLNLQSQLPTSLSQYSINRTEII 354 Legionella pneu...
WP_058464857 410 EKCISSPHYKQFLDLIGDTKDLEVYVYKAPVSYFTYLHDEHQSFRDFTASVKRNVHDLFVLLREGIVFSQLADIFHTHSD 489 Legionella cinc...
WP_011216062 417 DISRLSPNSERFRDLIDDAKDLEVYVYKAPLSYFTYLHDEHQNLEQLTTSVKTNVHDLFVLLREGIVFPQLADIFHTHIG 496 Legionella pneu...
WP_128130275 411 EKCLKSPHYRQFVDLIGDTRDLEVYVYKAPVSYFTYLHDEHQSFSDFTASVKRNIHDLFVLLREGIVFSQLADIFHTHSE 490 Legionella sain...
WP_003634608 408 EKCIESPYYKQFLDLIGETADLEVYVYKAPATYFTYLHDEHQSFRDFTASVKRNVNDLFVLLREGIVFSQLADIFHTHSE 487 Legionella long...
WP_058499657 420 EQCSN----KQFLQLISDTTDLEVYVYKAPVSYFTYLHDEHQSFRDFTASVKKNVHDLFVLLREGIVFSQLADIFHTHSS 495 Legionella grat...
WP_027222619 355 EKCRKSPGFEKFENLISDAKNLEVYVYKAISSYFTYLHDKQQSLRQFTSSVQKNVHDLFVLLREGIVFPYLADMFHTHID 434 Legionella pneu...
WP_021437194 355 EKCSKSPDFEKFKNLISDAKSLEIYVYKATPSYFTYLHDKQQSFSQLTSSVQKNVHDLFMLLREGIVFPYLADMFHTHID 434 Legionella pneu...
WP_058464857 490 EEERVDKGRYQALVQLLSIFQSQLGRLDKWQKAVEFVNLRASGIADLGDSIPITSLLTASEFTRKYFSELLTGGYHQT-- 567 Legionella cinc...
WP_011216062 497 EDEREDKGRYQSLVQLLNVLQFQLGRIDKWQKAVEFVNLRGSGLADLGDSLPITSLFTSSDFTKHYFSELLTGGYHPT-- 574 Legionella pneu...
WP_128130275 491 EDGRLDKGRYQALVQLLSVFQSQLGRLDKWQKAVEFVNLRASGIADLGDSLPITSLLTGSEYTRKYFSELLTGGYHQT-- 568 Legionella sain...
WP_003634608 488 EEGRLDKGRYQALVQLLSVFQSQLGRLDKWQKAVEFVNLRASGIADLGDSLPITSLLTSSEFTRKYFSELLTGGYHQT-- 565 Legionella long...
WP_058499657 496 EEERVDKGRYQALVQLLSVFQSQLGRLDKWQKAVEFVNLRASGLADLGDSLPITNLFTSSEFTKKYFSELLTGGYHQT-- 573 Legionella grat...
WP_027222619 435 KGKRNDKGRYQALVELLSALQSQMGRLDKWQKAVEFVNLRVSGIADLGDNLPLTSFLTVSDWTKHYHEELLTGAYHPSfl 514 Legionella pneu...
WP_021437194 435 ESKRSDKGRYQTLVELLSALQSQMGRLDKWQKAVEFVNLRASGIADLGDNLPLISFLTVSDWTKHYHAELLTGVYHPSfl 514 Legionella pneu...
WP_058464857 568 FFDSSSGTASSLYTNKRKLFGNYLYLNTIAEYLLVIQLVVGTYGDKVTRKIDNPSIKQHMWQQLAELMFDSCAEAVTLMT 647 Legionella cinc...
WP_011216062 575 FFDKSSGTANSLFTGKRRLFGNYLYLNTIAEYLLVIQLTLGSYGDKVTRDMMDKPKKEAIWRELANVMFSSCAETIHIMT 654 Legionella pneu...
WP_128130275 569 FFDSSTGSASSLYTGKRKLFGNYLYLNTIAEYLLVIQLVLGSYGDKVTRKIDDPSNKQYMWQQLAELMFDSCAEAVTLMT 648 Legionella sain...
WP_003634608 566 FFDSSNGTASSLYTGKRKLFGNYLYLNTIAEYLLVIQLVLGAYGDKVTRKIEDLYTKQYMWRQLTELMFDSCAEAVTLMT 645 Legionella long...
WP_058499657 574 FFDSSNDTASSLYTGKRKLFGNYLYLNTIAEYLLVIQLILGSYGDKVTRKIDPSM-KQHIWQQLTELMFDSCAEAVTLMT 652 Legionella grat...
WP_027222619 515 FLDKSSGSVRSLFNSRRRVFGNYLYLNIIAEYLLVIQLAIGSYGDKVTRKMDTKS-KIKVWEDLAELMFSSCAEAVNLIT 593 Legionella pneu...
WP_021437194 515 FLDKSSGSVRSLFNSRRKVFGNYLYLNIIAEYLLVIQLVIGCYGDKVTRKMDSKS-KAKVWEHLAELMFSSCAEAVNLIT 593 Legionella pneu...
WP_058464857 648 GIPHSRALALLNQRAKIDNHLQQTQFWMTPDYADLDETEMRMQQYVLYPGEAGYEVNSEVVPGIGLSVDGINQDLGGYNQ 727 Legionella cinc...
WP_011216062 655 GIPQSRALTLLKQRANIEKHFRQTQFWMTPDYSKLDEETLQMEQYSIYSGEPEYEFTDKLVSGVGLSVDGVHQDLGGYNR 734 Legionella pneu...
WP_128130275 649 GIPHSRALTLLNQRAKIDNHLQQTQFWMTPDYADLGESEMRMQQYVLYPGEAGYEINSEIIPGIGLSVDGVNQDLGGYNQ 728 Legionella sain...
WP_003634608 646 GIPHSRARALLNQRAKIDNHLQQTQFWMTPDYADLGESEMRMQQYVLYPGEAGYEINGEIIPGIGLSVDGVNQDLGGYNQ 725 Legionella long...
WP_058499657 653 GIPHSRALALLNQRAKMSNHLLQTQFWMTPDYASLDESEMRMQQYVLYPGEAGYEVNSELTPGIGLSVDGVNQDLGGYNQ 732 Legionella grat...
WP_027222619 594 GIPKSRALSFIKQRANVRKHTQQTSFWMTPDYSNMDSLSIQSQQSNMYPGESDYEINSDLVPGLGLSLDGINQDLGDYNQ 673 Legionella pneu...
WP_021437194 594 GMPKSRALAFLKQRANVRKHTQQTSFWMTPDYSNLDRLSVQSQQSTLYPGESDYEINSDLIPGVGLSLDGINQDLGDYNQ 673 Legionella pneu...
WP_058464857 728 ELPLRELEKLLYATVTLVEGTMQLDKEFFKQITQTEKLIESSC--SAEDCYQAAAKLLDMARPGCHFQKRLALSYYEEIK 805 Legionella cinc...
WP_011216062 735 ESPLRELEKLLYATVTLIEGTMQLDKEFFKQLQQVEKILSGEIktDASSCFEAVAQLLDLARPGCHFQKRLVLSYYEEAK 814 Legionella pneu...
WP_128130275 729 ELPLREFEKLLYATVTLIEGTTQLDKEFFKQIEQTEALIMSNC--SAEDCYQAAAKLLDMARPECHFQKRLALSYYEEIK 806 Legionella sain...
WP_003634608 726 ELPLRELEKLLYATVTLIEGTMQLDNEFFKQIEQTEKLIASGC--SAEDSYQAAAKLLDMARPGCHFQKRLALSYYDEIK 803 Legionella long...
WP_058499657 733 ELPLRELEKLLYATVTLIEGTMQLDKEFFKQIEQTEKLMVHNY--GAEECYQAVAKLLDMARPGCHFQKRLALSYYEEIK 810 Legionella grat...
WP_027222619 674 ASPLRELEKLLYATVTLIEGTQQLDKQFFQQLNETEKMIASAA--ETDKCYQAVAKLLELARPGCQMQRRLALSYYDTIK 751 Legionella pneu...
WP_021437194 674 ASPLRELEKLLYATVTLIEGTQQLDKQFFQQLDETEKMILSAA--GVDKCYQAVAKLLDLARPGCQMQRRLAFTYYEMIK 751 Legionella pneu...
WP_058464857 806 LKYPSSSQ--TDIDTRFEKVEKHFAVKTIQSFWQNylAHKKLVSE 848 Legionella cincinnatiensis
WP_011216062 815 LKYPSEPT--DSYDSRFQVVAKTNATITIQRFWRE--ARKNLSEN 855 Legionella pneumophila
WP_128130275 807 LKYPSSLQ--TDIDKRFEKVEKHFAVKTIQSFWRNyqTHKTLGSE 849 Legionella sainthelensi
WP_003634608 804 LKYPSSSQ--TDIDKRFEKVEKHFAVQTIQSFWRNylAHKKSVTE 846 Legionella longbeachae
WP_058499657 811 LKYHSSSEmiTDIDMRFKKVEKHFAAKTIQSFWRSylDHKKLVSK 855 Legionella gratiana
WP_027222619 752 RIHPYS----NPYDLRFELVAKEEAITKIQRFWRE---HKKEDPS 789 Legionella pneumophila
WP_021437194 752 RIYPCS----NPADVRFELVAKEEAIIKIQRFWRE---HKKENQS 789 Legionella pneumophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap