Conserved Protein Domain Family
SidA_fam

?
NF033872: SidA_fam 
T4SS effector SidA family protein
The founding member of this protein family, SidD from Legionella pneumophila, is a minimally characterized type IV secretion system substrate. Homologs are found in a wide range of Legionella species.
Statistics
?
PSSM-Id: 411436
Aligned: 18 rows
Threshold Bit Score: 356.214
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_031565363  11 LSQAMEALKIRIKDAEEQQK-PFLDTVHKRSKLAQYLVEALQKGFGLLTPILQAAEELRITGFAFQMFAVIPNAITTLTD 89  Legionella wads...
WP_058515275  11 LSEQMNELKNRITQLQQQQKlSFIEKINKRGNLSKFFLDGVQKILDFVTSIITSSKELPIIGFVMRMISAIPNAITTLTD 90  Legionella sant...
WP_108337471   8 LSERMNALKSRIRQAERET--SLVDEINKRGNYANNALGLFSQIQGFFASIFSQSKQLPIIGFILQMVSVIPTAITTLFA 85  Legionella taur...
WP_058527473   8 LSERMKTLKTRIKKAEREA--SLQDEVNERGEYANTVLSAFSQIQGFFASIFSESKQLPIIGFIIQMVSVIPTTITTIFA 85  Legionella erythra
WP_061483837  11 LSDKMMTLKKNLQDQLTQSK-SLGEQIHDGTTTASTITTGINHLFNVIASFLSSYRQIPLVGGVLQLVAILAKSISIVSD 89  Legionella pneu...
WP_018576524  11 LSPKMGLLKKELENRALHHQ-SFIEEVHKGSNLLSNVTGFIHHTFNIISSAMSAAKAIPLLGAFIQLASVVPKAIAILTD 89  Legionella shak...
WP_028383581  11 LSDKMQRLKENILALLLERK-TLMEQVYEGSRFASLVTTGISNVFNVIASFLSSFKTIPIIGSVFQTIAAIPQAISFIAD 89  Legionella mora...
WP_058475034  11 LSEKMQRLKNNILALLLERK-SFMERVYEGSRFATIITTGISNVFNVIASFLSSFQSIPLIGSIFQGIAAIPQAISFIAD 89  Legionella quat...
WP_058494120  11 LSEKMQRLKKHILNLLSEKK-TFMEKVHERSKFIALITLGINNAFNIIVALFRSFKTIPIIGGIFQTIAAIPMVISLISD 89  Legionella wors...
WP_115712770   9 LTEDMKKIKSKIKELDSKTKlPIQVRIYKKNNRIKNVINGAINIFNVIADALKSSKSIGIIGFAINMLATIPSSIAIITN 88  Legionella sain...
WP_031565363  90 KKSSIANKILASFILLGTTALGITAFVLGGIVAAGIGVAVSALATLIEGVSFIGSLISRSQTNKAYNEKKLFMELIKNRD 169 Legionella wads...
WP_058515275  91 KKSSVGSKILATTLLLVTTGFGIAAFVLGGIVSAGIGLAFASLGTLIEGISLLSSIIEKYQSAKAYKEKKIFMDLMEKRD 170 Legionella sant...
WP_108337471  86 KDKTVGEKLFAMGVLVVVTALSIAAFVLTAAVSAAIGVAVSALTTVLEGISLAGSIAAKLTTRAEYKQKKEFNQLLEARN 165 Legionella taur...
WP_058527473  86 KDKSIGEKVFALGVLSVVTALSIAAFVLTAAVSAAIGVAVSSFTTVLEGISLVGSIATKLSTRAEYKQKKEFTQLLEAKN 165 Legionella erythra
WP_061483837  90 PEKSIAEKIISSILIAAIIALSITAITLGGLAAAIIGTVIASTVTIMEGLGFFGKIAEKFQLANSYKMKKEFIDLVAKRI 169 Legionella pneu...
WP_018576524  90 PEKSKSEKAISALLILVLVALSIVALTVGSSAALIVGIVMASIVTAVDGLGFIGSIFEKYKISQAYNLKKELDGLLEQRI 169 Legionella shak...
WP_028383581  90 PKITFTQKAITGLVLLVVGGIALAAFMLGSIATLILGTVFSSIFTLLEGYNFTTRVIDKFKKSNRYNESKEFVTLIQERR 169 Legionella mora...
WP_058475034  90 PKITLAQKALSGLLLAVVGGIALTAFLLGSVATLIFGTVISSILTLMEGYFFTNRVIDKYQKSKRYNERNEFMTLIAERR 169 Legionella quat...
WP_058494120  90 PTITLKQKALGGILCLTIGAVALAAFFLLNVAVMIFAIIGSSLFTLFLGYESISLLMDKIDSSKNYHEQKELRSLIESRN 169 Legionella wors...
WP_115712770  89 PNKTIREKSKALMNLIAITSISIVAFIVGVKMAAIFAIVASTITLIFKSKEFINCILNKCQQSPPHQESQ---------- 158 Legionella sain...
WP_031565363 170 FDtLKEEKYRERLVIRALELQHLIEKQsi--lSHAHAEEELDFILHICDpqkyvpsekvngiqkfinfirnTMGLHLIPp 247 Legionella wads...
WP_058515275 171 LS-ALDDTYRERLEIRALELKFLLNKpn--slFSERMEEELEFINTIRA----------------------QKGWKQLPf 225 Legionella sant...
WP_108337471 166 TTaLADEKYLDPLRVRYLELQQALRDPdlkeeDKNNHQTESTFIHDLLT----------------------QRGLTLEGd 223 Legionella taur...
WP_058527473 166 TAaLTDEKYLDPLRVRYLELQQALVHPdletdEKNKYQEEATFIHDLLT----------------------QRGLPLDGd 223 Legionella erythra
WP_061483837 170 EP--DNDKYNDLLEIRAIELQHELEKSypnqiEQQQLKEELNFINAVLK----------------------KKNIIPGNn 225 Legionella pneu...
WP_018576524 170 MP--ENDKYNDELELRALELEHKISTNkladeEKKRFVEELEFINSILK----------------------QKNIVAGNk 225 Legionella shak...
WP_028383581 170 YP--ETDKYNEQLEVRAVELEHLVAGNqlkkeTKRKLKDELGFIKGILN----------------------KKEIIIGQn 225 Legionella mora...
WP_058475034 170 YP--EEDKYNDQLEVRAVELEHALSRNglnkdKKRKIEDELGFINGVLN----------------------KKGIVIGEn 225 Legionella quat...
WP_058494120 170 YP--DGDEYNEQLEIRAVQLNYILARKslkkeRKTLLKEELEFINAILE----------------------QKKIIIGAn 225 Legionella wors...
WP_115712770 159 ---------RAELARNAVELQHMIKRGinaqsNQEILDKIIHILGDELK--------------------------AIKNn 203 Legionella sain...
WP_031565363 248 -EEDKVTKLLQLYQDRQLLI----IYLAQMIKIF---QQKEDd--tISKFFFIGVISAIQQDIAELDKEVETLTEPLHEL 317 Legionella wads...
WP_058515275 226 sDDSLPSKLLGLYQERDEML----LYLKKMIQIIekeDMTGTt---VGNSQLIELVSNLQHEITQIDEDIEKITEPLHKL 298 Legionella sant...
WP_108337471 224 -EESQAGKLKKCYDQRREKMla-lTVLVENLEKV---ADSMTp---DERKTRIAAIDALKEGIVKLDTEITGITKPIHQL 295 Legionella taur...
WP_058527473 224 -EDSQAGMLKKLYDKRREKM----LALTVMIENL---EKIGDhitpEEKKANLVAIDSLKEDIVKVDNDINNITKPIQQL 295 Legionella erythra
WP_061483837 226 -KENDAYKLNQLYAKRAEQL----KTLVDKIALI---NPTGKs---AEQNKLLNEIKSLQKEITKTDGSIEEIIAPLAKI 294 Legionella pneu...
WP_018576524 226 -PNSSALKLKQHYATRQEQM----SALTDKLVEA---ESSKDd---NLKAKILDEILEMEKELILTERAIEDLTKSTEEL 294 Legionella shak...
WP_028383581 226 -PENTASQLSELYKIHKEQL----RELAEKLSLI---TEVTKl---EGHDEILDEIQKIQKDILTTEEEISLITKPIQEL 294 Legionella mora...
WP_058475034 226 -PESTASQLSELYKIHKEQL----HELTEKLSLI---TEETKl---EGHSEILDEIQKIQKAILTTEEDIAYFTKPINEL 294 Legionella quat...
WP_058494120 226 -TANKAAKLAKLYKSHQLQLeqltKILAEKLPLV-----TEEi---NDDDELLQEIHAIQMAILSTRKDIANIIKPLAEY 296 Legionella wors...
WP_115712770 204 -PNSSAYKLKK-RNKKMEQL----STLAYQPNL---------------QAQDIEQIKLLQKEIIILDKEIESISHSAEIH 262 Legionella sain...
WP_031565363 318 ERNHIIAKEAIAKSTVNLALGAGALTLSVVGLVILLGTLAAPPILGPVLIGFGVGLAVFGVIKWGLELYFKRQDEKIMKE 397 Legionella wads...
WP_058515275 299 KQQNLLANETIAKSYTNFALGGVGVILSVIGLMVLISAFAAPPLAGTILFGFGIGLASFGLIKWGVEQYANKEDKKLIKE 378 Legionella sant...
WP_108337471 296 KRNDLLANEKLAQTYTTFALAGAGVVLSTIALLMAVSVVAAPPVLLPIVGGLAIAMATIGLIKWVAEKFAEKQDTKADKE 375 Legionella taur...
WP_058527473 296 KRKDLLANEKLAQTYTTFALAGAGVVLSTIALLMAVSVVAAPPVLLPIVGGLAIAMATIGLIKWLAEKFAEKADAKADKE 375 Legionella erythra
WP_061483837 295 ERDNLKSTINLPLSYSTFAIAAASTLISIAGLLVVAGVIAAPPIMVPIMFAVGSVMAIIGLIKWTAEKMAEIEDAQLKAE 374 Legionella pneu...
WP_018576524 295 NAESFMASSTIALSGSTAALSAAGLVISVLALVLVVGGVAAPQFVIPAVIGIGIGLAVLGFMKFVAEKLVEMETNRRKEN 374 Legionella shak...
WP_028383581 295 NFENNLASDKLSISFSTFMLNAAATLVSFMGLLLGIGVIAAPHVFVPIMVGVGISLAVAGLIRWIAEKVTQYDERTYMRK 374 Legionella mora...
WP_058475034 295 YFENEMATDKLGLSLSTFVLSAAATIVSIIGLLVGLGVLLAPPIFVPIMAGVGASLAVVGLVKWIAEKITQQQERSYLAK 374 Legionella quat...
WP_058494120 297 DFEYTLAKGKLGLSLSSLTINTITTIISILILLIGMGVITAQPVLFPILIAIDTTFAVLGLMRWIAEKVTLHEEQSHQRK 376 Legionella wors...
WP_115712770 263 HLKVLQSNENLARSYSTFALSVAGVVFATLGLL-LVGVTV-SPILTPIMLSISIGIATFNLLKWTVEKYAYFKDITKTYQ 340 Legionella sain...
WP_031565363 398 REKENKLIILEESL 411 Legionella wadsworthii
WP_058515275 379 RTKEHEDTILEEAL 392 Legionella santicrucis
WP_108337471 376 RQVLKEESILDESL 389 Legionella taurinensis
WP_058527473 376 RQALKEENILDESL 389 Legionella erythra
WP_061483837 375 ETAKHEDAVLDEAL 388 Legionella pneumophila
WP_018576524 375 KAIVRKEGLRNEML 388 Legionella shakespearei
WP_028383581 375 KEEHQKETILDESL 388 Legionella moravica
WP_058475034 375 KEEHQKVTILEESL 388 Legionella quateirensis
WP_058494120 377 NEERQKEGILIEAL 390 Legionella worsleiensis
WP_115712770 341 NEEYQKEDILNEAL 354 Legionella sainthelensi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap