Conserved Protein Domain Family
sm_mem_Ecr

?
NF033861: sm_mem_Ecr 
Ecr family regulatory small membrane protein
Ecr, as described in the genus Enterobacter, is a small membrane protein predicted to span the inner membrane. It was found to modulate expression of PhoP, part of the PhoP-PhoQ two component system, which in turn induces the arnBCADTEF operon, leading to modification of LPS and conferring elevated resistance to colistin. The form described in PMID:31169899 (WP_048029797.1), at 72 amino acids in length, is aberrant compared with the typical length for the majority of family members, about 46 residues.
Statistics
?
PSSM-Id: 411429
Aligned: 20 rows
Threshold Bit Score: 45.7942
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:KPK_1934         2 MSKTEIFLLILLAVILLGCVWFIFSDEIWLLLCYLESKIYPTFSVP 47 
jgi:Entcl_1953       35 MGKTEVIMIILILLILGCGIWFVFSDQLWTMVSYLETLLYPGIVTP 80 
macrogen:RORB6_02990  1 MSKSEIALLVIVIIILLGALWFIFSGEIWTLVCYLESRLYPSIVAP 46 
cnhgcs:N559_1907      1 MSKTEIFLLIILAVILLGSIWFIFSDEIWLLLCYLESQIYPTFSFP 46 
IGS:CSC17_5390        1 MSKTEILLLAILLIILSAALWFIFSDEIWFIVSYLETTLYPSFVTP 46 
EHM45885              1 MSKTEIALLLLLVAVLAFGLWFIFSDQVWIVSSWIETWLYPAIEAP 46 
EKP28095              1 MSKTEILLLAILLIILAAALWFIFSGQIWFLVSFLETWLYPSFVAP 46 
OUF42954              1 MSKTETALIVLVMLILAFGIWFIFSGAIWSFVSYFETLLYPELHTP 46 
SAT55594              2 ISKTEIFLLIILAVVLLGSIWFIFSNEIWLLLCYLESQIFPTFSVP 47 
SLN95447              1 MSKTEMFLLIILAIILVGCIWFIFSDEIWLLLCYLESQIYPTFSVP 46 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap