Conserved Protein Domain Family
small_YshB

?
NF033841: small_YshB 
YshB family small membrane protein
YshB, a membrane-associated protein typically 36 to 40 amino acids in length, is found conserved in genera of the gamma-proteobacteria including Cronobacter, Enterobacter, Escherichia, Klebiella, Salmonella, and Serratia. The gene symbol derives from E. coli K-12.
Statistics
?
PSSM-Id: 411410
Aligned: 22 rows
Threshold Bit Score: 26.2268
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_017348888  1 MFETFIRIISHDvMAIVTAASHAPQTAIAALMCAIMFQLFQ 41  Pantoea sp. A4
WP_012886722  1 MLESIFSAVTHG-AEISSAMGPSSQTAIAAVLCAALINFFS 40  Enterobacterales
WP_015855608  1 MLESLISAVTHG-AELSNAVGHTSQTAIAAVLCAALINFFS 40  Musicola
WP_005968249  1 MLDSLISAATHS-AEIGSVASHSPQTAIAAVLCAALISFFS 40  Pectobacterium wasabiae
WP_009115022  1 MLDSLISVATHG-AEISTAASHSPQAAIAAVLCAALINFFS 40  Brenneria
WP_008457389  1 MLESVIHMVTRG-AEAGAAAGHSPQTAVAAVMCALLVSFFS 40  Enterobacteriaceae
WP_007872049  1 MLESLIHIATQS-AEAGVAAGHTPQTAIAALLCAALVNFFS 40  Cronobacter sakazakii
WP_006709255  1 MQGSFIELISQG-AELGTAACHNPQVAIAAVLCATLINFFS 40  Serratia symbiotica
WP_015379453  1 MLDSFIVFISQG-AELGSAASHTPQAAVAAVLCAALINFFS 40  Enterobacterales
WP_005280558  1 MIDSLYAMLSHG-AELSSAGGPSSHAAVAAVLCAALFHLLG 40  Edwardsiella tarda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap