Conserved Protein Domain Family
GarQ_core

?
NF033837: GarQ_core 
garvicin Q family class II bacteriocin core domain
This HMM describes the core (mature) peptide region of GarQ, the class II bacteriocin garvicin (garvieacin) Q, and homologous peptide with similar core regions. Some members, such as GarQ itself, have a classical GlyGly-containing ComC/BlpC-like leader peptide, but others have N-terminal regions (probable leader peptides) of a different type.
Statistics
?
PSSM-Id: 411406
Aligned: 15 rows
Threshold Bit Score: 55.0791
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PCS20759     20 MNGANGYFAYDNwNKKYVYHVTKDPVSAVAGVLANGWGSAGAG 62 
WP_039694458 32 MEGANGYACRYS-NGQWDYKVTKGVFQATTDVIANGWIKSMGQ 73  Streptococcus gallolyticus
WP_086269000 12 FNGANGYLSRDK-YGHYTYTVTKGPLEAAFGVMANGWASTAGS 53  Enterococcus
EQC79567     12 FNGANGYLSRDK-YGHYTYTVTKGPLEAALGVMVNGRASTAGG 53 
WP_040087900 25 FYGANGYLTRE--NGKYKYVVTKGPLEATLGVITNGWAGAAAG 65  Lactococcus garvieae
WP_128833820 26 FDGANGYAYRDS-QGHWGYKVTKSPAQALTDVVVNSWASGAAS 67  Streptococcus troglodytae
BAH88694     22 YDGANGYAYRDS-QGHWAYKVTKTPAQALTDVVVNSWASGAAS 63 
WP_003081942 26 YDGANGYAYRDA-QGHWGYKVTKSPAQALANVVVNSWASSAAN 67  Streptococcus macacae
WP_002997545 29 MDCANGYAYRDE-NGHWSYQVTKSPLEAALNITVNSWASGVAS 70  Streptococcus
WP_109990520 22 FGGSNGYSWRDK-RGHWHYTVTKGGFETVIGIIGDGWGSAGAP 63  Lacticaseibacillus paracasei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap