Conserved Protein Domain Family
TOMM_BorA

?
NF033803: TOMM_BorA 
TOMM family putative cytolysin BorA
The BorA family of thiazole/oxazole-modified microcin (TOMM) peptides that are putative cytolysins and virulence factors have been found, so far, encoded by plasmids in members of the genus Borreliella.
Statistics
?
PSSM-Id: 411383
Aligned: 3 rows
Threshold Bit Score: 41.5798
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_128650804  1 MFIRNKHFLTSIGISANYAVIPGGCCCSCTCSCSFSL 37  Borreliella valaisiana
WP_128650805  1 MFIRNKHFLTSIGTNANYAVIPGSCCCSCTCSCSFSI 37  Borreliella afzelii
WP_128650806  1 MFIRNKHFLTSIGINANYAVIPGSCCCSCTCSCSFSL 37  Borreliella spielmanii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap