Conserved Protein Domain Family
chaper_CopZ_Bs

?
NF033795: chaper_CopZ_Bs 
copper chaperone CopZ
This model describes CopZ, a small copper chaperone, as found in Bacillus subtilis and related species. A number of longer protein, such as copper-translocating P-type ATPases, contain multiple CopZ-like domains, with its signature invariant CxxC motif. CopZ from other species may be more different in sequence from this family than some of those domains of longer proteins.
Statistics
?
PSSM-Id: 411375
Aligned: 92 rows
Threshold Bit Score: 89.8463
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000432705  3 NVTLQVEGMSCGHCVNSIEGNVGALNGVENVKVHLDKGTVEVKFDSSVITLKDILVEIEDQGYDVQ 68  Bacillus cereus group
WP_008591150  2 EKTLNVEGMTCGHCESAVKGALAELDGVKEVQVSLDTGKVDVTYEEGKVTDEQMKDAVEEQGYDVK 67  Salimicrobium
WP_010024322  3 ERVLTVEGMSCGHCKMAVSGALKELDGVSSVDVNLETGKVDVAYDEAKVGFDQMKDAIEDQGYDVV 68  Sporolactobacillus
WP_010530268  2 QTTLDVKGMTCGHCESAVKGALEGIEGVQGVEVSLDTGKVNVIYDEAIANIESMRAAVEEQGYDVV 67  Lentibacillus jeotgali
WP_010632716  3 KTTLNVHGMSCGHCKMAVTNALKELDGVSNVSVDLENGKAAVEYDESKVQFDNMKDAVEEQGYDVV 68  Sporolactobacillus vineae
WP_011065544  2 NKTLLVQGMSCGHCKQSVEGALNSVEGVSEVSVNLSTGEVNVSFDDNKVTTELLEDTVEEQGYDIV 67  Oceanobacillus iheyensis
WP_014644689  2 QTTIKVEGMTCEHCEKAVTGALKELDGVEEVQVDLATGNVEVS-TSKEVSREAMADTIEDQGYDVV 66  Halobacillus halophilus
WP_017149912  2 TVTLNVQGMTCNHCKMAVTNALQELAGVKNVEVELQAGTVAVEYDEAKVNVEQLKDVIEEQGYDIV 67  Bacillus
WP_017185158  2 ELTLNVQGMSCGNCKQAVQGALKNLDGIASVEVHLDSGKVDVSFDEDTVSTEEVKEAIEEQGYDVT 67  Alkalibacillus haloalkaliphilus
WP_019378671  2 QTTLDVRGMTCGHCEQAVKNALEELSGVTGVEVHLNTGKVDVTYDNAQVTIAKMREAIEEQGYDVV 67  Virgibacillus halodenitrificans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap