Conserved Protein Domain Family
social_mot_Tgl

?
NF033762: social_mot_Tgl 
social motility TPR repeat lipoprotein Tgl
Social motility in delta-proteobacterial species such as Myxococcus xanthus depends on a type VI pilus, which in turn depends on assembly of the PilQ secretin complex. Tgl, a tetratricopeptide repeat (TPR) outer membrane lipoprotein, is required for PilQ assembly.
Statistics
?
PSSM-Id: 411346
Aligned: 13 rows
Threshold Bit Score: 453.853
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011553134   1 MFRLSTAsCSLALLLVSSGCSHTPTEKEKRSAEIHYDLALQAQQAGELQDALRELQVSLKNDPDYPDANNAMGILLHLAF 80  Myxococcus
WP_015349112   1 MLRLASAsCSLALLLALSGCAHVPSEKERRLAEIHYDLAITAQQDGHIQDAVRELGVALKNDPDYPEANNAMGVLMHLVF 80  Myxococcus stip...
WP_046713320   1 MLRFASAfRPLALVLALAGCAHVPTEKERRKAEIHYELALQAQQQGHVQDALRELQVSLENDPDYPEANNAIGILLHLAF 80  Myxococcus fulvus
WP_120209852   1 MPRIFLA-CSLAVVVALAGCVHVPTDKERNSSQIHFDLGVQQQQNGDVQDALREFQKALEYNPENAEAHNAMGILLHLAF 79  unclassified Co...
WP_120647199   1 MFRIPSA-CCLAFVLASAGCAHVPTEKELRSSEIHYDLGVQAQQHGHVQDALAEYQKALDQNPDNPEAHNAMGILLHLSF 79  Corallococcus l...
WP_120541007   1 MFRIPSA-CCLALVLASAGCAHVPTEKERESSEIHYDLGVQAQQHGHVQDALQEYQKALEINPSNPEAHNAMGILLHLSF 79  Corallococcus t...
WP_120526751   1 MSRITSS-CFLAFALASAGCAHVPTEKERRSSEIHYDLGVQAQQHGHVQDALAEYQKALEQNPDNPEAHNAMGLLLHLSF 79  Corallococcus e...
WP_120587551   1 MSRINSS-CFLAFALASAGCAHVPTEKERQSSEIHYDLGIQAQQHGHVQDALQEYQKALEQNPGNPEAHNAVGVLLHLSF 79  Corallococcus s...
WP_044186068   1 MVRVSLV-SSLALALLLSGCRHIPTEKERQTAEIRYNLGVQAQQAGNIQEALSEFQRAVEIDPDNAEAQNALGILLHLSF 79  Hyalangium minutum
WP_013376570   1 MPRLIPA-WPLALALVLSGCKHIPTEKERQSSEIHYNLGIQAQQAGSIQEALSEFQQAVALDPDNADARNALGIVLHLSF 79  Stigmatella aur...
WP_075010953   1 MPRLFPA-WPLALVLALSGCKHVPTERERQSSEIHYNLGIQAQEAGNVQEALSEFQQAVTLDPNNPEARNALGIILHLSF 79  Stigmatella
WP_108076695   1 -MLRLHP--AWLLALALMGCKHVPTEQERQGAEIHYELGLQAQQMGSVQEAYKEMQKSLELDPDYPEAHNAIGILLHMAF 77  Vitiosangium sp...
WP_073558302   1 MHRRLSS--AWLLALALVGCRHVPTEQERRGAELRYELGLQAQAAGSVQDAYKEMEKSLALDPEYPEAHNAMAILLHLAF 78  Archangium sp. ...
WP_011553134  81 RRPDEAVKHYTKALEVRPDFSEARTNLANVHLDQGRYDDAIKLYELVLNDMLYPTPFIAQGNLGWAYYKKGEPDRAVESI 160 Myxococcus
WP_015349112  81 QRHNEAAEHYQRALKVRPNFSEARTNLANVHLDQGNYDEAIKLYELVLNDMTYLTPYIAQGNLGWALYKKGETERGVGSL 160 Myxococcus stip...
WP_046713320  81 ARHAEAMGHYERALKVRPTFSEARTNLANVHLDQGRYDEAIKLYEQVLNDMLYVTPYIAQGNMGWAFYKKGDTQRAVGSL 160 Myxococcus fulvus
WP_120209852  80 RRPAEAKGHYEEALKLRPTFSEARTNLANVELDQGRYDQAIKLYEEVLNDMLYATPFIAQGNLGWAQYKKGETDKALQSI 159 unclassified Co...
WP_120647199  80 RRLDEASTHYEKALKLRPTFSDARTNLGNLRLDQGRYDEAIKLYEEALNDMQYRFAFSAQGNMGWALYKKGDTANALQNI 159 Corallococcus l...
WP_120541007  80 RRLDEAAAHYEKALELRPTFSDVRNNLGNLRLDQGRYDDAIKLYEAALNDMQYRFGFSAQGNLGWAQYKKGDTANALQNI 159 Corallococcus t...
WP_120526751  80 RRLDEASSHYEQALKLRPSFSDARTNLGNLRLDQGRYDDAIKLYEESLNDMQYRYGFSAQNNMGWALYKKGDTVNALQNI 159 Corallococcus e...
WP_120587551  80 RRLDEASAHYEKALTLRPSFSDARTNLGNLRLDQGRYDEAIKLYEESLNDMQYRNGYSAQGNLGWALYKKGDTANALQNI 159 Corallococcus s...
WP_044186068  80 RRHAEAIEHYQKALEIRPTFSEARSNLANVYLDQGQYDQAIKLYEQVLNDMLYPTPFIAQGNMGWAYYKKGDTEKGLENI 159 Hyalangium minutum
WP_013376570  80 GRHAEALAEYEKALELRPNFSEARSNLGNVYLDQGRYDEAIRTYEQVLNDMLYPTPFIAQSNLGWAYFKKGDTAKALENI 159 Stigmatella aur...
WP_075010953  80 GRHAEAIAEYEKALELRPNFSEARSNLGNVFLDQGRYDEAIKSYEQVLNDMLYPTPFIAQSNMGWAYFKKGDTAKALENI 159 Stigmatella
WP_108076695  78 NRPEEAIQHYRKALEVRPGFSEAKTNLANVYLSQSRYDEAIKLYEAALNDMLYTTPFIAQGNMGWALYKKGELERGLQSI 157 Vitiosangium sp...
WP_073558302  79 NRPEEAIQHYKKALEYRPGFSEAKTNLANVYLSQARYDEAIKLYEQSLNDMLYPTPFIAQGNLGWALYKKGDTERALQNI 158 Archangium sp. ...
WP_011553134 161 KAAVTTNPNFCLGYKNLGLIYDETGRTSEACRQFTHYRENCPDVAEAYMREGVCQAKLGQVDAAKAAFATCETKAKAGEQ 240 Myxococcus
WP_015349112 161 KAAVTTNPGFCMGYRNLGIIFDETGRTEDSCRQLTRFRETCPEVAEAYMREGVCLAKLGQADAAKQSFAVCETKAKPAEQ 240 Myxococcus stip...
WP_046713320 161 KAAVTTNPGFCMGYRNLGIIFDETGKLDESCRNFSRYRENCPEAADAHMREGVCLAKQGQAEGARQAFSTCEAKAKAGEQ 240 Myxococcus fulvus
WP_120209852 160 KAAVTLNPNFCLGYKNLGLIYDETGRTEDACRQFGRYRENCPEVADAYLREGVCQAKLGQVEAAKQAFSQCEAKAKASEQ 239 unclassified Co...
WP_120647199 160 KAAVTTNPEFCMGFRNLGIIYDETGKTEEACRQFANYREKCPDAAEAYHREGVCQAKLGQVDAAKKAFAGCEAKAQPNEQ 239 Corallococcus l...
WP_120541007 160 KASVTTNPEFCMGFRNLGIIYDETGKTAEACMQFGHYREKCPDTAEAYHREGVCQAKLGNVDAAKAALAGCEAKAQATEQ 239 Corallococcus t...
WP_120526751 160 KAAITTNPEFCLGYKNLGIIYDETGKTEEACRQFTHYREKCPDVAEAYHREGVCQAKLGRADEAKAAFAGCEAKAQPNEQ 239 Corallococcus e...
WP_120587551 160 KSAVTTNPDFCLGYKNLGIIYDETGKTEEACRQFGNYREKCPDVADAYRREGVCQAKLGRVEEAKKAFAGCEAKAQPNEQ 239 Corallococcus s...
WP_044186068 160 KAAVTLNPNFCLGFKNLGLIYEQTGSTEEACKQFAHYREQCPDVADAHMREGVCLAKLGQGDAARERLQTCEAKADQPSQ 239 Hyalangium minutum
WP_013376570 160 KSAVTLNPNFCRGYQNLGFIYDQTGDTEEACRQFSRYREMCPDVADAYMREGVCQAKMGKADAARESFTTCENKAAQP-- 237 Stigmatella aur...
WP_075010953 160 KASVTLNPSFCRGYQNLGFIYDQQGETEEACRQFGRYREMCPEVADAYMREGVCQAKLGKADAARESFTSCENKAAQP-- 237 Stigmatella
WP_108076695 158 KASVTTNPGFCLGYKNLGIIYDETGNVSEACRYFGRYREACPDVADAYLREGACQVKQGKMEEARQSFTACEAKAKSQ-- 235 Vitiosangium sp...
WP_073558302 159 KASVTTNPGFCMGYKNLGVIYEETGNVSDACRYFGRYREACPDVADAYLREGACQLKQGKMEEARQSFAACEAKAKSQ-- 236 Archangium sp. ...
WP_011553134 241 -VLKDDCRRLLEKL 253 Myxococcus
WP_015349112 241 -GIKDDCRRLLEKL 253 Myxococcus stipitatus
WP_046713320 241 -ELRDDCRRLLEKL 253 Myxococcus fulvus
WP_120209852 240 -GLKDDCQRLLGHL 252 unclassified Corallococcus
WP_120647199 240 -VLKDDCRQLLEHL 252 Corallococcus llansteffanensis
WP_120541007 240 -VLKDDCRSLLEHL 252 Corallococcus terminator
WP_120526751 240 -VLKDDCRSLLDHL 252 Corallococcus exercitus
WP_120587551 240 -VLKDDCRSLLDHL 252 Corallococcus sp. CA054B
WP_044186068 240 kQLKDECQRLRENL 253 Hyalangium minutum
WP_013376570 238 -ALKDECRRLREHL 250 Stigmatella aurantiaca
WP_075010953 238 -ALKDECRRLREHL 250 Stigmatella
WP_108076695 236 -GLQDDCRRLLEAL 248 Vitiosangium sp. GDMCC 1.1324
WP_073558302 237 -VLKDDCHRLLEAL 249 Archangium sp. Cb G35
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap