Conserved Protein Domain Family
gliding_GltC

?
NF033756: gliding_GltC 
adventurous gliding motility protein GltC
GltC is a soluble periplasmic protein required for a type of gliding motility found in certain social delta-proteobacteria, including the model species Myxococcus xanthus.
Statistics
?
PSSM-Id: 468172
Aligned: 10 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_020477632    17 LAWTAPTYAQ-NFEGLDLSGQSKKKKRtt-pKKKptrkSRADKAKPAPAQDDDadDDAAAASSSEAPts----------v 84  Myxococcus
WP_041791895    17 LVWATPAPAQ-SFEGLDVPGASKKKRKpaasKKK----KKPARGKKAVEAEDTs-ESESTPSASESPvvpa-----dtag 85  Stigmatella a...
WP_044196201    17 LVWAMPAPAQ-SFEGLDTSSSKKKKKG-----KAstssKKKKKGKKGSSSDEE--SSSVAPTETTPTvpaatdtatetap 88  Hyalangium mi...
WP_073561461    17 LAWATPSPAQ-SFEGLDLSQPSKKKKKt---RKPp--rGKKPAATQA--SEDD--SDSDSDASDTSAat----------t 76  Archangium sp...
PZR08841        14 AALATPAFGQmNFEGLDLGGKKKKGGKka-------ggKKTGKKDPKKGDEDK--GDEGAEATGEVP------------- 71 
RPH67237        14 LLIAGGAWGQ-TFQGLDSPQQPKKKKAa---KKSsstkSAASKSSTTAP------ASSTAPATSVAPasat------vpa 77 
RMG16842        19 LVWPRAARAQmTFEGLDLSDDGEDEGK-------------DDTGKDATGDDVEiqIGGSEVSGg---------------- 69 
PEL:AKJ08_1698  21 VASPLAVHAQiSFEGLDLSDDSDSKKPap-aRRAp--pKQQPKRRAPPP------------------------------- 66 
PZM93582        13 LAIAQGAWAQiRLEGVDLSGGEDEAAQq---------------------------------------------------- 40 
OFX22825        16 VGLAVPSSAQl---GIDLTPKEKAKAK----AKKp-----------sPK------------------------------- 46 
WP_020477632    85 SPAETAPAAAPSTPAP-TPASppANTGSMGMGLDLt--QEAPKPA--APTMSFDAVDVSGKTADR-QRLDVAVSLFKNDE 158 Myxococcus
WP_041791895    86 SPSEAPSPSPGVAPGPvSAPA--AEQPTEGLGLDLt--GSSSKGT--APTMSFDAVDVSGKTADR-QRLDVAVSLFKNDE 158 Stigmatella a...
WP_044196201    89 SPAPTEAPNPVSAPA--TPAA--QDTQSGGLGLDLtgsGNSNKPQ--SGGMTFEAVDVSGKSTDR-QKLDVAVSLFKNDE 161 Hyalangium mi...
WP_073561461    77 TPADTGTA----TSAPaAPAAqdSSANQGGMGLDLt--AETPSQPkaAPTMSFDAVDVSGKSGDR-QRLDVAIALFKNEE 149 Archangium sp...
PZR08841        72 -----LPAGGLDLSKP--PPA-----------------EEKPKEVkaAPTMSFEAVDVSGKSGDR-QKVDAAIAKFKADN 126
RPH67237        78 ASAPAATPAKAQEGLDlSSPTpaKAKQEMPM-------PPPPPKKgtAPTTTFEALDVSGRTADR-QRLEAANASFNRGE 149
RMG16842        70 ----------------------dETMSFEGMGLDLs--DEE-------------------KSAAQ-RALDAAVALYDGEN 105
PEL:AKJ08_1698  67 PPRKSAPAAPPVQAAP-EAPAq---------------pKALPTRP--PPTLSFEGFDVTGKTADR-QKLDAAMRLFQEKS 127
PZM93582        41 ----------------------kEEESAGSLGLDL---REGPEVP--------DEVDVRMRAATR---------LFEERN 78 
OFX22825        47 ------APEAPKAPEA-RPAS-----------------------P--QAPVSMPELDLGARKGEAgKRVAEANKVFAGGD 94 
WP_020477632   159 YEKASMAAHELLEDPKLAGLHTEARYVLAKSLYRMGMYHSSLGEFSKILSLGPS-TKFFKTSLEWLFFISRKTKNETVIL 237 Myxococcus
WP_041791895   159 YEQASMSAYEVLQDPKMSGLHTEARYVVAKSLYRMGLYHSALGEFSKILSLGPQ-TKFFKTSLEWLFFISRKTKNETVVL 237 Stigmatella a...
WP_044196201   162 YEQAAMAAYEVLKDQQQAGNHVEARYVVAKALYRMGLYHSSLGEFSKILAVGPQ-TKFFKTSLEWLFFISRKTKNETVIL 240 Hyalangium mi...
WP_073561461   150 YEKAAMSSFEMLQDAKLAGLHMEARYVMAKALYRMGLYHSSLGEFSKILAVGPE-TKFFRTSLEWLFFISRKTKNETVIL 228 Archangium sp...
PZR08841       127 FEAAALDFFELSQDPSLAGLAVENEYWLAKSLYKLGMYHSSLQLFSKVLARGPT-TKFFKSSLEWLFFIARKTVNETVVL 205
RPH67237       150 NDKAALAAWELMYDPKMAPLQLESQYLLGKTLYRMGQYHAALGEFSQILARGKD-TKFFSKSLEWLFFISHKTVNESVIL 228
RMG16842       106 YDAAAVAFYKILQDPKAAEHHQQAEYLLAKSLYKMGLYHSALAYFKRILSAGEA-HKYFSVSLEWLFFISRKMVNESVVL 184
PEL:AKJ08_1698 128 FETAALGFHEILQDPTAADQHPQAEYLLGKSLYRLGMYHSSLSVFRRILDRGEA-HPYFATSLEWLFFIAHKATNQTVVL 206
PZM93582        79 YEAAALGFWEIIQDPKAASAHSRAEYMLGKSLYRLGMYHSALAIFKRILERGES-DRFFATSLEWLFFIAHKTTNQTVVL 157
OFX22825        95 YETAALAYDALLRDPALAEVHDEARYQLAKSLVKLELSHSALAKLDEILSRGPQgTRYFHNALEWLFEVGKKTVNESVIV 174
WP_020477632   238 DEIARHANQEFPEKYRNEFRYLLARYHFVRGRA-LDQV---------GQPEEADKSFSEVKRLALTIPR----------- 296 Myxococcus
WP_041791895   238 DEIARYANYEFPEKFRSEFRYLLARYHFVRGRA-LDQV---------GQTAEADKSFEEVKRLALTVPR----------- 296 Stigmatella a...
WP_044196201   241 DEIARYANYEFPEKFRSEFHYLLARYHFVRGRA-LDQV---------GQQDQADKSFEEVKRLTTLIPR----------- 299 Hyalangium mi...
WP_073561461   229 DEIAKYANQEFPERFRTEFHYLLARYHFVRGRA-LDQV---------GRAEDADKSFNEVKRLTLLIPK----------- 287 Archangium sp...
PZR08841       206 DEIARYSNYEFPERFRNEFRYLLARYNLVRGKA-LDDN---------GQTGDATKSFDEVKRMALLIPK----------- 264
RPH67237       229 DEVARYANADWPERYRDEFHYLLARYHFVRGRA-LDTV---------EQKAEAAKSFEEARKLALTIPP----------- 287
RMG16842       185 EDIAAYADKEFPEKYRDEFLYLLAKYHFTRGRA-LMEA---------GESDEAEQSFAEADRLLGGISD----------- 243
PEL:AKJ08_1698 207 DEIARFAGVEFPEKYRDEYRYLLAKYNFVRGKAlLDAAqgvdeaakrGHLQQAQESFDEARRLLAMVPR----------- 275
PZM93582       158 DEIARFAGVAFPERYQDEYRYLLAKYNFVRGRA-LMDAhavqggtttAYADAAQQSLEEARRLVAMIGA----------- 225
OFX22825       175 SEVVRHGGGALLPANQDKFNYLLARYSYERGRA-LDEA---------GQASEARRAYEEARRLAGQVRQeaggaaqkkgd 244
WP_020477632   297 -TDPFFPRAKYLEGLSFFRNGSRQkdaaakrangemlAAIEAMKEVVRLTRPAPGKTADQAKLDKSLRELAFMQLARTHY 375 Myxococcus
WP_041791895   297 -TDAFYPRVKFLQGIALFRFGTKQksadgrrgdtnmmQSIEAMKEVIRLTRPNAAKGGEEAKLDQSLRELAFMQLARTHY 375 Stigmatella a...
WP_044196201   300 -SDAFYPRAKFLEGLAYFRNGNKVrsaearrsdtsmaSAIEAMKEVVRLTRPG-GKTGEEAKLDQSLRELAFMQLARTHY 377 Hyalangium mi...
WP_073561461   288 -TDAFYPRAKYLEGLAFFRFGNRAtsaaakrtdintvGAIEAMKEIIRVTRSSAGLDAEQAAANQKLRELAFMQLGRTHY 366 Archangium sp...
PZR08841       265 -GDPFYPRAKYLEGLAYFRenk-------------leTALETMKEVVKVTRQAEGPMTAERKQLQALRELAFMQLARTHY 330
RPH67237       288 -SSRFYAQARYLEGLTWFRDGKMP-------------MALEAMKEVVRVTRPSGNRTPADAKVADATRDLAFMQLARIHY 353
RMG16842       244 -QTKFYPKALFLQGLILYQRGDAN-------------GALAKFKEVVKLTSPRTGRLK-----NTDLRDLAYMQLARLHY 304
PEL:AKJ08_1698 276 -GSRFNAKARYLDGLTLYVNGKFT-------------PALEAFKDVVRALNPRRG-----GVVDTQLREQALMQLARIHY 336
PZM93582       226 -GSPFYPKAKYLEGLALYATGKPA-------------LAVESFKDVVRATNPRREDTI----FDPKLRELAFMQLGRIHY 287
OFX22825       245 dEGDVYAKARFVDALVRYAEGDGQ-------------GAVESFKDVVRLTNPRRARAP-----DPRLRELAFLQLARIHY 306
WP_020477632   376 GMQQNRFALFYLGKVERGNTQWLEALFESSWANYRVGQYEQALGSLITLSSPFFREEYFPEALILKAVIYYENCRYRESN 455 Myxococcus
WP_041791895   376 GMQQNRYAIFYFNKIERGTTQWLESMFESSWANYRVGQYEQALGNLITLSSPFFREEYFPEALILKAVIYYENCRYREST 455 Stigmatella a...
WP_044196201   378 GMQQNRYAIFYFGKIERGTTQWLEAMFEASWANYRVGQYEQALGNLITLSSPFFRDEYFPEALILKAVIYYENCRYRESS 457 Hyalangium mi...
WP_073561461   367 GMQQNRYALFYFNKVERGTSQWLESMFESSWANYRVGQYEQALGNLITLSSPFFREEYFPEAMILKAVIYYENCRYRESS 446 Archangium sp...
PZR08841       331 GARQNRAAIFYYDKVERGGVQWLEALFEASWSHYRIGQYEQALGNLITLSSPFFRDEYFPEALILKAVVYFENCRYRESL 410
RPH67237       354 GARQNRYALYYYGKIERGKPQWLEALFESAWANYRIGQYEQALGNLITLSSPFFRDEYFPEALILKAVIYYENCRYAEST 433
RMG16842       305 EHKQNVFAAGYYNKIPRDSEQWLQSLFESSWAYFRLGDYERALGNMVTLHSPFFADEYFPESLILKAVIYYENCRYPEAK 384
PEL:AKJ08_1698 337 EHGQNRFAAFYYSRIARGSEQWLQSLYEASWAHFRLGENEQALGNMITLQSPFFRDEYFPEAMVLQSVIYYENCRYPEAN 416
PZM93582       288 EHRQNRYANFYYSRIVRGSDQWLASLFESAWAYFRLGEDEKALGNLLTLRSPFFKDEYYPEAMLLEAVIYYENCRYPEAR 367
OFX22825       307 EHKQNRYAIFYYDKMPWGGESWLEGLWEASYAHYRVGNYEKALGNLLTLQSPYFRDEWFPESWILKATIYYENCRYPEAR 386
WP_020477632   456 IILQDFERTYLPVHDQLEALVKKNMEASE-YYSVLSDVQKKNKDGLEKNET-DIILERILRLALTDQDLRKTNDSILELE 533 Myxococcus
WP_041791895   456 LILQDFERTYLPVHDQLDLLVKKNMDASE-YYSVLSEVQKKNKEGLEKNGT-DVILERILRLALTDQDLKKTNDSILELE 533 Stigmatella a...
WP_044196201   458 LILQDFERTYLPVHDQLQLLVQKNMEAGE-YYSVLADVQKKDKEKL--SGT-EVILERILRLALTDQDLKKTNDSILELE 533 Hyalangium mi...
WP_073561461   447 LILQDFERTYLPVHDQLELITKKQLEASE-YYGVLSDVQKKNKEGLEKGET-DAILERILRLALTDQDLKKTNESILELE 524 Archangium sp...
PZR08841       411 TIIEDFENIYGPVQDELDVLVGKNMEATE-YFNVLDEVRKKNKEGKKLRGT-DEILERILNLALTDKDLKKTVDSIAELE 488
RPH67237       434 AIIREFERRYKPVYDALDDLTRKNMEAAD-YYAVLADIQKKNRAAAKAGQSpDIILERVLKLALSDKDLKNTNESIIELE 512
RMG16842       385 LIVEEFESIYGPVHEELAKLAASGKTPVE-YYELLADVQRRERAGQPTSGV----LARILKAALTDKEFKAMNDSIQEVE 459
PEL:AKJ08_1698 417 RIVEEFRARYYSLYAELEKILARPFSTPQdYYGVLADLQKDEKGG----ET-NRMLQGILKLALSDKELRHLNDSILELE 491
PZM93582       368 RAVESFLERYGPLHRALTKLLERELPSPQaYWDALA--------GLEEGEE-NELLARIVRMALSDQELRHLSDSIAELE 438
OFX22825       387 AILDDFHGTYEGVHGELDQLTARQMQPAA-FFDLIEDAEKGRGTAA------RPLMRRIMKLAFTDQNVKRLNDSILEVE 459
WP_020477632   534 AEMD-AFANRADTFKYSELSKSLLEGLKVQRTALISKAGIMAKGKLETELVALKQLLANGLRIKFETTTKEKEFLEEQLK 612 Myxococcus
WP_041791895   534 GEMD-LFGEKKDTFKYSELSKALLEGLKEQRTSLISRAGIMAKGKLETELMALKQLLANGLRIKFETTTKEKEFLEEQLK 612 Stigmatella a...
WP_044196201   534 GELD-AFGAKGDTFKYSELSKELLEGLKEQRTGLIQKAGIMSKGKLETELIALKQLLANGLRIKFETTTKEKEFLEEQLK 612 Hyalangium mi...
WP_073561461   525 TEMD-TFGEKGDTFRYSELSKQLLEGLKTQRTSLIEKAGIMAKGKLETELVALKQLLANGLRIKFETVTKEKEFLEEQLK 603 Archangium sp...
PZR08841       489 TEMD-TFGTKGDTFKYSNLTKQLIEQLKTQRQELIGKAGLMAKAKLEFELGQLKTLRANGLRIKFETNSKEKEFLEEMLK 567
RPH67237       513 NELE-SERSHP-SLNNTDLAKHLQDLLKKQRSALIQKAGLMAKAKLEQEQNELRTLLGNGERIKFETTTKEKEFLEEQLQ 590
RMG16842       460 REMD-SIAEQEQVFKFSPLAKELLEHLKSERQELIQKAGLMASAKLYAEKESLKDLLSQGLRIRFETQSREKEFLEKQLQ 538
PEL:AKJ08_1698 492 GELD-GIASRRELFRFSGLAKSLIADLDAQRVELQRKAGFYAKRKLEKERKELASLNYRALAIKAEIGTSEKDVLEASLS 570
PZM93582       439 AEVK-SISQRREIFRFSGLARHLIAELEEQRRALAVKAGHHTKRKLEREARELGQLNYRALAIKAEISSREKEALQASLE 517
OFX22825       460 DEMDrGLAARREAFRSSALYRDLKEKLTGERRRLVEEAGARARGKLEYERDALKGLLQQALRIKIEVARKEREALESALS 539
WP_020477632   613 AGGRTAIVKKYKYSVAVQDDQLYWPYEGEYWRDELGTYQYTMTKGCIER 661 Myxococcus
WP_041791895   613 AGGRTAIVKKYRYSVAVPDDQLYWPYEGEYWRDELGTYQYTMTKGCIER 661 Stigmatella aurantiaca
WP_044196201   613 AGGKTAIVKKYRYTVAVADDQLYWPYEGEYWRDELGTYQYTLTKGCIER 661 Hyalangium minutum
WP_073561461   604 AGGKTAIVKKYRYSVAVADDQLYWPYEGEYWRDELGTFQYTMTKGCIQR 652 Archangium sp. Cb G35
PZR08841       568 AGGQQSIVKPYKYSTAVGDDYLYWPYVGEYWRDELGTYQYTLTKGCIAR 616
RPH67237       591 AGGRRAIVKQYKYSVAVNDDQLYWPFQGEFWRDELGTYQYTLTKGCIER 639
RMG16842       539 AGGKLDVVQAYGYSVAVSDEELYWPYEGEYWRDELGTYQYTLTKGCKER 587
PEL:AKJ08_1698 571 KGKRVSPIENYKYSTAVDDEHVYWPYEGEFWRDELGTYQYTLTKGCKGR 619
PZM93582       518 KGESVTVVRPYRYSTAVDDEHVYWPYEGEFWRDELGSYEYTLTRGCKEK 566
OFX22825       540 HGGQVNVLRDYRYSVAVSDEQLYWPYDGEFWRDELGTYTYTLTKGC--R 586
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap