Conserved Protein Domain Family
vWF_bind_Staph

?
NF033750: vWF_bind_Staph 
von Willebrand factor binding protein Vwb
The von Willebrand factor binding protein Vwb, like its paralog staphylocoagulase, is a coagulase and a virulence factor. It induces clotting, not by being an enzyme, but by activating prothrombin to generate fibrin.
Statistics
?
PSSM-Id: 468168
Aligned: 9 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000791707   1 MKNKLLVLSLGALCVSQIWESNRASAVVSGEENPYKSESLKLNGKRS-TTITSDKYEENLDMLISSLSFADYEKYEEPEY 79  Staphylococcus
AAK52333       1 MKNKLLVLSLGALCVSQIWESNRASAVVSGEKNPYVSESLKLTNNKN-KSRTVEEYKKSLDDLIWSFPNLDNERFDNPEY 79 
WP_000791696   1 MKNKLLVLSLGALCVSQIWEHNHASAVVSGEKNPYVSESLKLIDYKNnKQYTAEAYKKSLEDLIDTLPQIGNVKYDEPEF 80  Staphylococcus ...
WP_000791701   1 MKNKLLVLSLGALCVSQIWESNHASAVVSGEKNPYVSKALELKDKSN-KSNSYENYRDSLESLISSLSFADYEKYEEPEY 79  Staphylococcus ...
WP_001837865   1 MKNKLLVLSLGALCVSQIWEYNHASAVVSGEKNPYKSESLKLTGKRS-NTVTPVMYKENLEKLIASLSFSDYEKYYEPEY 79  Staphylococcus ...
WP_000791705   1 MKNKLLVLSLGALCVSQIWESNRACAVVSGEKNLYVSESLKLNDNKS-KSLSLEKYKESLRSIMCTKEINKNDGYDEPEY 79  Staphylococcus ...
WP_000791704   1 MKNKLLVLSLGALCVSQIWESNHASAVVSGEKNPYVSKALSIKGQKT-NSWNLGQYKDSLRTVMCTSEINKNDGYDEPEY 79  Staphylococcus ...
WP_000791736   1 MKNKLLVLSLGALCVSQIWESNRASAVVSGEKNPYVSKALSVSGQKS-NNWSLEQYKESLNKLITSIDIQDHDGYDELEY 79  Staphylococcus
WP_000731019   1 MKKKVLILTLGALCASQLWNSDNASAIVTGEANVYKSSSLNVGGYVS-SSEQAKRYLDSLDDLIYYNSVNRHAGYEEPEY 79  Staphylococcus ...
WP_000791707  80 KEAVKKYQQKFMAEDDALKKFFSEEKKIKNRntntNTNTSNYLGLTHERYESIYNSLKKHREEFSKEIEEINNKNPELKE 159 Staphylococcus
AAK52333      80 KEAMKKYQQRFMAEDEALKKFFSEEKKIKNG----NTDNLDYLGLSHERYESVFNTLKKQSEEFLKEIEDIKKDNPELKD 155
WP_000791696  81 KETVKKYQQRFMAEDDALKKYFGEERLLKQTtv-nNGLNSNILGMTQGRYELIYEGLKNQSAEFLKEIEQVKNNNPQLKD 159 Staphylococcus ...
WP_000791701  80 EKAVKKYQQKFMAEDDALKNFLNEEKKIKNAd--iSRKSNDLLGLTHERYSYIFDTLKKNKQEFLKDIEEIQLKNSDLKD 157 Staphylococcus ...
WP_001837865  80 KEAVKTYQQKFMAEDAALKKFFREEKHIKEN-----TNTNEMLGLTEERYQHIYDKLKSNNEWFMKEIKIIQERYQDLKD 154 Staphylococcus ...
WP_000791705  80 KEALNTYRKKLFAELDALNKFLDEERKIASYikknMEVPSNILGLTHGRYTAIYNAIKENKNEFEKNVENIESKHLDLKR 159 Staphylococcus ...
WP_000791704  80 KEAMDTYRKKLFAELDALNKFLDEERKIESSkknnNQVANGVLGLTHQRYLAIHEAIKENKNEFERKTQDIESRNPDLKK 159 Staphylococcus ...
WP_000791736  80 KDINEKYQKKFLAEIDALNKFIDEERKIAYYsknnIQIPADILGLTHERYLKIYESLQENKKEFDIESKKIEEKHPELKR 159 Staphylococcus
WP_000731019  80 KEVYDKYQKKFLAEIDAVNKFRQEQKKVDNYn--rYDRNNYLYGLTYERYINVYNSLKANREDFDKEVKKIEDKHEDLMR 157 Staphylococcus ...
WP_000791707 160 YNNEEQTKADTELNTLENQVLMIGYTFYHSNKNEVEDLYNKLDMILGYKDEERKKKRATNQRMFNNKKEDLETIIDEFFG 239 Staphylococcus
AAK52333     156 FNEEEQLKCDLELNKLENQILMLGKTFYQNYRDDVESLYSKLDLIMGYKDEERANKKAVNKRMLENKKEDLETIIDEFFS 235
WP_000791696 160 FSWEEQNKADIELNTLENKALMVGATYFNEHRDEVEDLYNKLDMILGYEEDERKSKKPINNRMLERTKEDLETIISEFFR 239 Staphylococcus ...
WP_000791701 158 FNNTEQHNADVEINNLENKVLMVGYTFYNTNKDEVEELYSELDLIVGEVQDKSDKKRAVNQRMLNRKKEDLEFIIDKFFK 237 Staphylococcus ...
WP_001837865 155 FDEKQQHDADVKINELENKVLMLGYTFGNV-GGARTNLYSKLDLILGYEDYERKYKQPTNSRMLNEKMEDLETIIDEFFE 233 Staphylococcus ...
WP_000791705 160 FDEDKDYEARVKLNELENKVLMLGQAFPDK-VDARESLYNKLDMIVGLSNDEIEERHPQNERLLKERVEDLETIIDEFFN 238 Staphylococcus ...
WP_000791704 160 FDRDKDYEVRVKLNELENKVLMLGHAFPNK-HEARENLYNKLDLIVGRSDDEREERHPQNDRLSKERVEDLESIIDEFFV 238 Staphylococcus ...
WP_000791736 160 YGNEEEYQANVKLNELENKVLMLGYAFFGN-KDARENLYNKLDMIVGLSKNEREDKIPKNKRMFEDRIKDLESIIDEFFV 238 Staphylococcus
WP_000731019 158 FYEIKQEQVNQEMNKLENQILMIGQAFIKTNRKAVLDMYNRLDMVVGTTEQERQNMLPTNERMRKIKIEDLETIIDEFFN 237 Staphylococcus ...
WP_000791707 240 EIGQQRPTSIPTLAPkeEKETNTNNANKLKYDTEAAKTDESKRSNRSKRSLDSQNYKSVSKEVTAEQKAEYEKRAEERKA 319 Staphylococcus
AAK52333     236 DIDKTRPNNIPVLEDekQEEKNHKNMAQLKSDTEAAKSDESKRSKRSKRSLNTQNHKPASQEVSEQQKAEYDKRAEERKA 315
WP_000791696 240 DIKKERPKDIPMLTA--DKNYNQTMALQLKADTEEAKTNTAK---RSKRSLNTQNHKSVSQEVSEQQKAEYDKRAEERKA 314 Staphylococcus ...
WP_000791701 238 KIQQERPESIPALTS--EKNHNQTMALKLKADTEEAKTNTAK---RSKRSLNTQNHKSASQEVTAKQKAEYERKAEERKA 312 Staphylococcus ...
WP_001837865 234 EIGKQRPINIPTLASekEKETNAKNANKLRADTEDAINDENKRCNRSKRSLDSQNYKSASQEVTAEQKAEYDKRAEERKA 313 Staphylococcus ...
WP_000791705 239 DIGENRPENISPLTN--NEYKNKEMITKLKSDTEAAKNDENKRCNRSKRSLDSQNYKSASQEVTAEQKAEYEKRAEERKA 316 Staphylococcus ...
WP_000791704 239 EINENRPLNIPALVE--SNEENIEMAKKLKADTEEAKTN---NAKRSKRSLNTQNYKSASQEVTAEQKAEYERKAEERKE 313 Staphylococcus ...
WP_000791736 239 EINENRPLNIPALVE--SNEENIVMAKKLKADTEEAKAN---TSKRSKRSLNTQNHKSKINEVTEEQKANYEKKFKEIKE 313 Staphylococcus
WP_000731019 238 DIGEKRPDNIPALTN--DEHKNKEMITKLKSDTEAAKKDVSK---RSKKNLGKQKHNSLSEEVSEEQKVKYNKEMEEIKE 312 Staphylococcus ...
WP_000791707 320 RFLDRQKSKK-EPVVSLEYDFEHKQRFNNANDKQLVVSAPTKKPTTPTTYTETTTQVPMPTVERQTQQQIVYKTPKPLVG 398 Staphylococcus
AAK52333     316 RFLDNQKIKK-TPVVSLEYDFEHKQRIDNENDKKLVVSAPTKKPTSPTTYTETTTQVPMPTVERQTQQQIIYNAPKQLAG 394
WP_000791696 315 KFLDKQKNKK-TPVVSLEYDFEHKQRVDNANDKQLVVSAPTKKPTTPTTYTETTTQVPMPTVERQTQQQIIYNAPKQLAG 393 Staphylococcus ...
WP_000791701 313 RFLDRQKSKK-EPVVSLEYDFEHKQRFNNANDKQLVVSAPSKKPTTPTTYTETTTQVPMLTVERQTQQQIVYKTPKPLAG 391 Staphylococcus ...
WP_001837865 314 RFLDNQKIKKt-PVVSLEYDFEHKQRIDNENDKQLVVSAPTKKPTTPATYTETTTQVPMPTVERQTQQQIIYNAPKQLAG 392 Staphylococcus ...
WP_000791705 317 RFLDNQKIKKt-PVVSLEYDFEHKQRIDNENDKKLVVSAPTKKPTSPTTYTETTTQVPMPTVERQTQQQIIYNAPKQLAG 395 Staphylococcus ...
WP_000791704 314 KFLAKN--KDn-PVVSLIDDED-----DNENDKQLVVSAPTKKPTTPTTYTETTTQVPMPTVERQTQQQIIYNAPKQLAG 385 Staphylococcus ...
WP_000791736 314 RFLAKQKYKNnTPVVSLEYDED-----DNENDKKLVVSAPSKKPTTPTTYTETTTQAPMPTVERQTQQQIIYNAPKQLAG 388 Staphylococcus
WP_000731019 313 KFLAKSKLRN--SVVSLIDDED-----DNGKDKQLIISTPTNKPITPPTYTETITQVPMPVLERQTQQQIIYNAPKQLAG 385 Staphylococcus ...
WP_000791707 399 LNGESHDFTTTHQSPTTSNHTHNNVVEFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKLVDNYKDTH 478 Staphylococcus
AAK52333     395 LNGESHDFTTTHQSPTTSNHTHNNVVEFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKLVDNYKDTH 474
WP_000791696 394 LNGESHDFSTTHQSLTTSNHTHNNVVEFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKLVDNYKDTH 473 Staphylococcus ...
WP_000791701 392 LNGESHDFTTTHQSPTTSNHTHNHLIEFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKLVDNYKDTH 471 Staphylococcus ...
WP_001837865 393 LNGESHDFTTTHQSPTTSNHTHNHLIEFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKLVDNYKDTH 472 Staphylococcus ...
WP_000791705 396 LNGESHDFTTTHQSPTTSNHTHNNVVEFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKLVDNYKDTH 475 Staphylococcus ...
WP_000791704 386 LNGESHDFTTTHQSPTTSNHTHNNVVKFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKLVDNYKDTH 465 Staphylococcus ...
WP_000791736 389 LNGESHDFTTTHQSPTTSNHTHNHLIEFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKLVDNYKDTH 468 Staphylococcus
WP_000731019 386 LNGESHDFTTTHQSPTTSNHTHNNVVEFEETSALPGRKSGSLVGISQIDSSHLTEREKRVIKREHVREAQKLVDNYKDTH 465 Staphylococcus ...
WP_000791707 479 SYRDRLNAQQKVNTLSEGHQKRFNKQINKVYNGK 512 Staphylococcus
AAK52333     475 SYKDRINAQQKVNTLSEGHQKRFNKQINKVYNGK 508
WP_000791696 474 SYKDRLNAQQKVNTLSEGHQKRFNKQINKVYNGK 507 Staphylococcus aureus
WP_000791701 472 SYKDRLNAQQKVNTLSEGHQKRFNKQINKVYNGK 505 Staphylococcus aureus
WP_001837865 473 SYKDRLNAQQKVNTLSEGHQKRFNKQINKVYNGK 506 Staphylococcus aureus
WP_000791705 476 SYKDRLNAQQKVNTLSESHQKRFNKQINKVYNGK 509 Staphylococcus aureus
WP_000791704 466 SYKDRLNAQQKVNTLSEGHQKRFNKQINKVYNGK 499 Staphylococcus aureus
WP_000791736 469 SYKDRLNAQQKVNTLSEGHQKRFNKQINKVYNGK 502 Staphylococcus
WP_000731019 466 SYNDRVKAQQKVNTLSAGHQKRFNKQINKVYSGQ 499 Staphylococcus aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap