Conserved Protein Domain Family
class_F_sortase

?
NF033748: class_F_sortase 
class F sortase
Statistics
?
PSSM-Id: 411332
Aligned: 136 rows
Threshold Bit Score: 183.421
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_018469365  58 PAREP-LPGARPVRVDVPSIGVSSaEVVSRGLDDAGAVDPP-SFDTPDTVGWYDSGPQPGEEGAALLVGHVDTRTR-PAV 134 Streptomyces
WP_018335049  54 PAPVR-LPASPPTRIAIPAIGVDS-VVNPSGLNPDGTLQVPaPGPRYDQAAWYTGSASPGQDGPSVILGHIDSAKNgPSV 131 Actinomycetospo...
WP_013018406  52 IAPPG-LSRSTPTVVDIAAIGVHS-PVTPVGLDRDGTIEAP-DLDQPHQTGWYSHGPAPGQIGTAALVGHVDSRRSgAAV 128 Stackebrandtia ...
WP_014689309  51 PTRSR-THRSQPTALDIPAIGVHT-PITPIGLRGDGTLDVP-PLRSDAPAGWYDGSPTPGEPGPAVVVGHVDTARDgAAV 127 unclassified Ac...
WP_013733965  49 PSLSP-LPRADPVEVRISRIGVRA-PLIAVAADPAGALEVP-PLDRPGVAGWYSPGVSPGEIGNAVLVGHVDSPVG-PAV 124 Micromonospora ...
WP_018784233  57 GTGGPaLPRSTPVRVTIPRIGVDA-EIVPVATDADGALEVP-PLERPTVTGWYHPGPTPGQAGNAVLVGHVDSQHG-PAV 133 Micromonospora ...
WP_020215199  67 PAPSG-LPRSTPSRIVIPRIDVNA-SIMELGTNPDGTVEVP-PLDQAQLAGWYEPGVSPGEVGNSVIVGHVDSAMIgPAV 143 Salinispora are...
WP_018788731 126 PAPAP-LPRSAPATISIPRIGVQA-PIMSLGTNPDGTVQVP-PLDQAMKAGWYSPGASPGEAGNAVIVGHVDSAQLgPAV 202 Micromonospora ...
WP_013735594  71 HVAAA-LPRSAPTTISIPRIGVQA-EIMSLGTNPDGTVQVP-PLDQALLAGWYEPGPSPGEVGNAVIVGHVDSAAIgPAV 147 Micromonospora ...
WP_018656171  48 PDGEA-LPFSPPARVTIPGIEVDA-PTMRLGQRDDGTVDVP-PFGRAEQAGWYEHGPAPGARGSAVVLGHYDDTGG-PAV 123 Actinomadura fl...
WP_018469365 135 FYTLSATEPGARVRVAREDGTVAEFTVEDVQVLEREGFDAQKAYAPreKGRAELRLITCGGTFDKARNTYTANVVVSAYL 214 Streptomyces
WP_018335049 132 FYRLAQLRPLDEFTVTRADGVVLVFRVNSVQQYPKDAFPSQEVYGP--TPRPEMRLITCGGAFDDSTRSYRDNTVVYASR 209 Actinomycetospo...
WP_013018406 129 FYDLGSLETGDSIVVSRRDGRDVTFTVDLVESYPKKKFPYGAVFTN--TGYAALRLITCGGNFDTKRRSYTHNIVVYATM 206 Stackebrandtia ...
WP_014689309 128 FYRLRELKPGDTLTIRRSDRSTVTFTVVKVASYPKKAFPSDEVYGP--TGGPALRLITCGGSFDRSRRSYRSNIVIYAVE 205 unclassified Ac...
WP_013733965 125 FFDLGRLRPGDTVHIARADATVVRFAVDGVVAYPKDGFPTDLVYGP--GAVAGLRLITCGGRFDQDSGEYVDNVIVFATR 202 Micromonospora ...
WP_018784233 134 FFDLGRLRGGDTIRVLRADGRTATFAVDGVGAYPKERFPTARVYGG--DAAARLRLITCGGRFDPRTGNYPDNIVVFATA 211 Micromonospora ...
WP_020215199 144 FYSLGALDPGDAISVVRDDGRQVDFTVDSVVSYPKTEFPTELVYGP--TDQIGLRVVTCGGTFDEAANSYPDNIVVFATL 221 Salinispora are...
WP_018788731 203 FFNLGALVPGDTIVVTRQDGSSATFTVREVGSYPKTAFPAAQVYGP--SAVPALRVVTCGGVFDRTAGSYLDNIVVYAPM 280 Micromonospora ...
WP_013735594 148 FFSLGALQPGDTITVARTDGKPASFQVDSVVSHPKDAFPTEQVYGP--NDRPGLRVITCGGQFDEVTGDYPDNVIVFASL 225 Micromonospora ...
WP_018656171 124 FYRLRELKPGARVKITRKDRRVAVFTVDAVERVPKFEFPRTRVYGD--VRYAGLRLVTCGGPYDRADRSYRDNVIVYAHL 201 Actinomadura fl...
WP_018469365 215 T 215 Streptomyces
WP_018335049 210 I 210 Actinomycetospora chiangmaiensis
WP_013018406 207 A 207 Stackebrandtia nassauensis
WP_014689309 206 A 206 unclassified Actinoplanes
WP_013733965 203 T 203 Micromonospora maris
WP_018784233 212 T 212 Micromonospora sp. CNB394
WP_020215199 222 A 222 Salinispora arenicola
WP_018788731 281 T 281 Micromonospora sp. CNB394
WP_013735594 226 T 226 Micromonospora maris
WP_018656171 202 T 202 Actinomadura flavalba
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap