Conserved Protein Domain Family
MFS_ArsK

?
NF033733: MFS_ArsK 
arsenite efflux MFS transporter ArsK
ArsK, a major facilitator superfamily (MFS) transporter, was shown in Agrobacterium tumefaciens to be induced by arsenite and antimonite, to reduce their accumulation, and to confer resistance when expressed heterologously.
Statistics
?
PSSM-Id: 411319
Aligned: 19 rows
Threshold Bit Score: 510.691
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014743722     22 AWSDIAALGLTQIIGYGTLYYSFGILAPAMARDLGWPEEWVFGALSIALLTGGLIAPWSGRWIDRFGAGRVMTAGSVTAV 101 Tistrella mo...
1_ncbifamImport   1 PAGIVAALGLTQIVGYGTLYYSFSILAPGMARDLGQTVEQVFAVFSASLLVGGLSAPIMGGWMDRFGAATIMTFGSAVSA 80 
WP_003495449      7 PAGIVSALGVTQIIGYGTLYYSFSILAPGMAKDFGISVERVFAIFSVSLFIGGLSAPFIGRHMDGIGAATVMTLGSALAA 86  Rhizobium/Ag...
WP_003518840      7 PAGIVSALGLTQIIGYGTLYYSFSILAPGMAADLGLTLAEVFGVFSASLFIGGLSATYVGRQMDRIGAATVMTIGSVLAA 86  Agrobacteriu...
WP_020809331      7 SAATVSALGLTQIVGYGTLYYSFSILAPGMAKDLGLTLSQVFAVFSVSLFIGGLSATYIGRQMDRIGAATMMTIGSFLAA 86  Agrobacteriu...
WP_016558384      9 SLTTISALGLTQIIGYGTLYYSFSILAPGMAKDLGITLEQVFGVFSASLFIGGLSAPVIGRQMDRAGATTVLTVGSVLSA 88  Rhizobium gr...
WP_004119907     10 PVAAILALGLTQIIGYGSLYYSFSILAPGIARDLKWSSKWIFGALSAGLLIGGLAAPAMGKWIDRFGAGRVMTAGSAIAA 89  Rhizobium
WP_017988654     10 PVAAIAALGLTQIIGYGSLYYSFSILAPDMARDLGWSSEWIFGALSAALLIGGLAAPLMGTWIDRFGAGRIMTSGSAIAA 89  Rhizobium le...
WP_012654318     19 DILVTIALGLTQIIGYGTLYYSFSILAPAMGLDLGWSSEWIFATLSAALLAGGLVAPWVGRIIDDHGAGRVLTVGSMIAA 98  Agrobacteriu...
WP_007693126     29 PLLVIAALGLTQIIGYGTLYYSFSILAPAMAHDFGWPTEWIFGVLSGALLIGGLAAPWAGRWIDHYGAARIMTVGSLAAA 108 Agrobacterium
WP_014743722    102 LALAVCAAAPSGFTFLPALIAIEIASTMVQYGAAFPLLVQRHPRTAQRSIVWLTLIAGFASTLFWPFTSWLHGFMSWREV 181 Tistrella mo...
1_ncbifamImport  81 VALLLCAWSPSMPVFAIAIVLLEVASGMVQYQAAFATLVEVRPKMASRSITYLTLIGGFASTIFWPIAVNLSELLSWREI 160
WP_003495449     87 FTLALCAWSPSVSLFALAIVLLEVSSGMVQYQAAFATLVESEPRTASRSITYLTLIGGFASTIFWPIAATLSGYLSWREI 166 Rhizobium/Ag...
WP_003518840     87 LTLALCAWSPSIAVFAVAIILLEISSGMVQYQAAFAALVESDPRSASRSITYLTLIGGFASTIFWPISAALSGYLSWREI 166 Agrobacteriu...
WP_020809331     87 LTLALCALSPSVAIFSAAVILLEISSGMVQYQAAFAALVENNPRSASRNITYLTLIGGFASTIFWPISAALAVHLDWREI 166 Agrobacteriu...
WP_016558384     89 LTLALCAWSPSVPVFALAIVLLEISSGMVQYQAAFAALVESEPKTASRSITYLTLIGGFASTIFWPISSALMECLSWREI 168 Rhizobium gr...
WP_004119907     90 AALVACAFASGKIAFVAALIALETASNLVQYGAAFALLVQIRPKVAQRSITYLTLIAGFASTIFWPITTALNAHMSWQNV 169 Rhizobium
WP_017988654     90 AALVACAFAPGKIAFVAALIGIEIASNLVQYGAAFALLVQIRPQVAQRSITYLTLIAGFASTIFWPITTALHAHLSWQNV 169 Rhizobium le...
WP_012654318     99 LSLAACAFAPGKITFVMALIVIEMASTLVQYTAAFAFLVQFRPQSAQRNITYLTLIAGFASTIFWPLTSALHADLSWRQV 178 Agrobacteriu...
WP_007693126    109 AALIACALAPVGIAFVPALIAVEIASTLVQYGAAFALLVQQQPRTAQRSIVHLTLIAGLASTIFWPFTTALHNALSWQQV 188 Agrobacterium
WP_014743722    182 YIVFAALNLMLCVPLHAWLSRp-AEADPKTlragQPASDPPESPQGSVAPANRRTAFILMAAAFAFQSFVSSAVLVHMLP 260 Tistrella mo...
1_ncbifamImport 161 YVAYAGLNLLICLPLHYWILR--SRKHGAV----ERSRIDGEAIAGALPTRVRRRGMLLVSWAFALQGFTLSAILTHMVP 234
WP_003495449    167 YLVFAALNLIVCMPLHYWIRRd-GRRVSKL-----DGTRTREVVAAALEPQARRRGMLLVSLAFSLSGFSLAAILAHMVP 240 Rhizobium/Ag...
WP_003518840    167 YLVFAGLNLFLCMPLHYWIMRv-GKTTSNG----DPAVRMRETVVGAVAPHARRRGMILVSFAFALLGFTLAAILAHMVP 241 Agrobacteriu...
WP_020809331    167 YLVFAGLNLFLCMPLHFWIMRa-GKTGPSA----DTTSRARETVVGALPSHTRRRGMILVSFAFAILGFTLSAILAHMVP 241 Agrobacteriu...
WP_016558384    169 YLAFAALNLLVCMPLHFWMMRr-GKAANAR-----GATRERERVIGVIPPEARRGAMIVVSAAFAILGFTLASILAHMVP 242 Rhizobium gr...
WP_004119907    170 YLVFAALNVAVCLPIHAWLSS--SVTRSRK----RASAEPAKHVEPSLSPSIRSPAFMLMVTGFALESFVNAALLVHMVP 243 Rhizobium
WP_017988654    170 HLIFAALNLVVCLPIHAWLSR--GVSQTRR----RTGEEAAKCVEPSLPPSVRRPAFILMVTGFALESFVNSALLVHMVP 243 Rhizobium le...
WP_012654318    179 YLVYALLHLAICLPLHLWLASrvGERHAPVv---APSATSHHIMEGGLPDRLRPIAFLLMVTGFALESFVNAALLVHMVP 255 Agrobacteriu...
WP_007693126    189 YFVFAAMNFFICLPIHAWLSRl-NRRPDKTg--dADATAPNATVDGSLPLAARRRGSILLSIGFALQSFVSSAILVHMLP 265 Agrobacterium
WP_014743722    261 MLGSLGLGVIGVTVGALFGPSQVASRLINMIFGRNLSQLILAAVAAALLPGALVLLTLTAPSIAGAMAFAVLFGMGNGLY 340 Tistrella mo...
1_ncbifamImport 235 MLGAIGFGPAAVVIGSLFGPSQVLSRLINMTLGANLLPPMLATLSAVLIVAGVVVLGLSGTWLPGAVAFAICLGLGSGIN 314
WP_003495449    241 MLGAIGLGSAAVVIGSLFGPAQVMSRLINMVFGKHLSPPALAIVSAALMVAGAVILGMSGDWLPGAVAFAICLGLGSGIN 320 Rhizobium/Ag...
WP_003518840    242 MLGSIGLGAAAVVIGSLFGPAQVLSRLINMIFGKSLSPPALAVLSAVLIVLGVLILLATGNWLPGAVAFAICLGLGSGIN 321 Agrobacteriu...
WP_020809331    242 MLGTVGLGAAAVVIGSLFGPAQVLSRLINMIFGKSLPPPALAVLSAVLIVLGILILLVTASWLPGAVAFAICLGLGSGIN 321 Agrobacteriu...
WP_016558384    243 MLGNLGLGTAAVVIGSLFGPAQVLSRLINMIFGTRLSPPLLAVISAALMVTGIVILGLSGSWLPGAIAFAICVGLGSGIN 322 Rhizobium gr...
WP_004119907    244 VLSGLGLGAMALMVGTLFGPSQVLSRFINMVFGGGLPQLVLALISAVLLPAALVILIVTAPSVPGALVFAVVFGLGSGLS 323 Rhizobium
WP_017988654    244 VMSALGLGAMAVVVGTLFGPSQVLSRLINMAFGESLSQVMLAIICAILLPAALVILIATAPSVPGALVFAVVFGLGSGLN 323 Rhizobium le...
WP_012654318    256 LLTALGLGSAALLVGTLFGPSQVLSRFTNMMFGRDLSQLTLALVSALLMPGAVAVLLLTAPSFSGALIFAVLFGLGSGLG 335 Agrobacteriu...
WP_007693126    266 LLGALGLGVAGVMVGTLFGPAQVTSRFINMMFGKNLSQLRLAMISAAMLPASAALLLLTAPSVPGALAFAVLFGMGNGLY 345 Agrobacterium
WP_014743722    341 SIVGGTLPLALFGADGYGRRQGQIMSVRLIVGSVAPFAFALIMHQLGIHTALGMSAGLGFCAVAALAMVAVLL 413 Tistrella mobilis
1_ncbifamImport 315 SIAQGSLPLWLFGSSGYGAITGRMAAARLAAAAMAPFVFSVLMERFGTNVALMANACLGAIGIAAFVAVASAA 387
WP_003495449    321 SIAQGSLPLYLFGSAGYGAITGKMAAARLATGATAPFAFAAAMNHFGTTISLFVIAALGTFGILAFGAVATSV 393 Rhizobium/Agrobacte...
WP_003518840    322 SIAQGSLPLYLFGSDGYGAITGKMAAARLAVGAGAPFVFASAMEHIGLNFALIANACLGAISIAAFVAVAASS 394 Agrobacterium tumef...
WP_020809331    322 SIAQGNLPLYLFGSEGYGAITGKMAAARLAVGAGAPFVFAALTENLGLSFALTLNACLGMVSIAAFVAVAVYA 394 Agrobacterium tumef...
WP_016558384    323 SIAQGSLPLYLFGSDGYGAITGRMAAARLAMGAAAPLVFAMAMERIGVGLSLFATAALGMVGMAAFVSVSMAT 395 Rhizobium grahamii
WP_004119907    324 SIVQGTLPLALFGSEGYGQRQGQVLAIRLVVSSTAPFILAFLMTNVGVFWSLTVAATVGAIAVFAFVAISRLA 396 Rhizobium
WP_017988654    324 SIVYGTLPLALFGSDGYGRRQGQIMSVRLVVSSMAPFALAFLMGNLGVSWSLSIAALLSTVAVAAFFAIMRLT 396 Rhizobium leguminos...
WP_012654318    336 SIVQGTLPLALFGSAGYGRRQGHVTAVRLVVSSTAPFAFAWMMENMGTDLALAINTAIGGVAVLAFLAIAHLA 408 Agrobacterium vitis
WP_007693126    346 SIVSGVLPLALFGSEGYGARQGQLMSVRLIVSSAAPFAFALLMENIGVNWALTITAILGSGALLAFLGIARLY 418 Agrobacterium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap