Conserved Protein Domain Family
borfam63

?
NF033731: borfam63 
fibronectin-binding protein RevA
Statistics
?
PSSM-Id: 411317
Aligned: 5 rows
Threshold Bit Score: 220.209
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_006434250   1 MKNKNIVKLFFISILLVMACNSYIKEKEEIDSILSKVPTLNNKTDIEEFKNYKGKLNELKERFKDVGNAELKEKMLNLQG 80  Borreliella spi...
WP_039949813   1 MKNKNIFKLFFVLMLFIMACKAYVEEKKQIDSLITDVSALNNKIDHEKFNYYKQEINKLKESLKDVGNAELKEKLLALES 80  Borreliella fin...
WP_075552649   1 MKNKNIFKLFFVSMLFIMACKAYVEEKKEIDSLSTDVLVLKNDSSGDTFKDYKDKINKLKESLKDVSNAELEEKLLKLQS 80  Borreliella may...
WP_010258452   1 MRNKNIFKLFFASMLFVMACKAYVEEKKEIDSLMEDVLALVNDSSGGKFKDYKDKINELKENLKDIGNAELKEKLLNLQN 80  Lyme disease sp...
WP_010883730   1 MRNKNIFKLFFAAMLFVMACKAYVEEKKEIDSLMEDVLALVNDSSGGKFKDYKDKINELKENLKDIGNAELKEKLLNLQN 80  Lyme disease sp...
WP_006434250  81 LFQDklaaKLAALREAKQKIEGITDSDTSTAKTKIWAEAKLVGVTVKFSGSNTSGKGAEMSKEAVGQIDKIIEFLEEGTH 160 Borreliella spi...
WP_039949813  81 LFQD----KLAALKAAKQKIEGTTDADNSTAKNKIWAESKLVGVTIKFSESNTTGKGQEMSKEAVEQIDEIIKFLEEGTN 156 Borreliella fin...
WP_075552649  81 LFKDklaaKLAALKAAKQTIEGYTDKDQK--KTDIWKEAKLVGVTVPFSGNNTSGKGQEMATNAVGQIEKIIKFLEEGTN 158 Borreliella may...
WP_010258452  81 SFQDklaaKLAALKAAKNTIENITDKDQDISKRKIWSEAKLVGVTVPLLGSNTSGNGDKMSKNAVEQIDKVIKFLEEGTN 160 Lyme disease sp...
WP_010883730  81 SFQDklaaKLAALKAAKNTIENITDKDQDISKRKIWSEAKLVGVTVPLLGSNTSGNGDKMSKNAVEQIDKVIKFLEEGTN 160 Lyme disease sp...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap