Conserved Protein Domain Family
borfam_49

?
NF033725: borfam_49 
chromosome replication/partitioning protein
Statistics
?
PSSM-Id: 411312
Aligned: 45 rows
Threshold Bit Score: 132.315
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010890312  37 YNELKEQLKLNLKSDINNKIQRMKILYEIKQKELYKYDGFKSFKQFIESYIIARSQAYMYLKIYEKVLEGIISIEKVKEM 116 Lyme disease sp...
WP_002657148  37 YKDLKEQLKLNLSNEIDTKIQRMRILYEIKTRKLYKYDGFKSFSQYLKTFVVAKTQAFFYLKLYSKILEGSISIDTIKEL 116 Lyme disease sp...
WP_012666283  39 YNNLKEKLKYNLKDDIDNKIERMKILYEIKKKELYKYDNFSNFEHFIKHFVIAKSQAYLYLRVYEKVLEGAISMDKIKEI 118 Borreliella
WP_010257233  37 YNNLKEQLKYNLKDDINNKIQRMKILYEIKQKELYKYDGFARFNDFIKSFEVAKSQAYRYLKIYQKVLEGKVSIDKIKEV 116 Lyme disease sp...
WP_012665630  37 YNNLKEQLKYNLKDDINNKIQRMKILYEIKQKELYKYDGFIHFNDFIKSFEVAKSQAYRYLKIYQKVLEGKVSIDKIKKV 116 Borreliella spi...
WP_029346842  24 YENYKHALKKSMVNDIENKIKIMEILYKIKSKKLYRIDGHVSFKSFIEEFLIARTQAYLYLKIYEQVLKGNLSIKEIRDK 103 Borreliella gar...
WP_002658520  28 YKSYKDQLRRITVDDVENKIKTMKILYKIREKKLYLIDGYKKFEDFLSEFIISRSQAFLYLKIYRKVLEGSISINDIKEK 107 Borreliella
WP_012672902  28 YKSYKDQLRRITVDDVENKIKTMKILYKIREKKLYLIDGYKKFEDFLSEFIISRSQAFLYLKIYRKVLEGSISINDIKEK 107 Borreliella fin...
WP_014017598  33 YESYKNQLRRITSSDINNKIELMEILYKIRIKKLYELDGYKKFEDFLKEFVIARSQAFLYLRLYKKVLSGDLKIEEIKQF 112 Borreliella bis...
WP_012622088  33 YESYKNQIRRITVSEVNNRIELMEILYKIRTKKLYQFDGYKKFDDFLKKFVIARSQAFLYLRLYKKVLSGDLKIEEIKQF 112 Borreliella gar...
WP_010890312 117 GFVATYKNILKNSLSEIYKENMVKenpeegvgtqNKSIRILMKDEKVYDFCKKDIKRIYFILEKLIKDKKNILSDLIIEY 196 Lyme disease sp...
WP_002657148 117 GFENIKKHIFKKKSFDFNNNNKSKld------nkNISIRIFMRDKELYEFVKQDIKRASYIFKELFQNRKDVLTDIVTKY 190 Lyme disease sp...
WP_012666283 119 GFRGVQRQLKEN-LLNVKKENLPEvn------nkRMSIRFLMKNKEFYTFCKEDTKRACYIFERLFFTKKEVLSDLINEY 191 Borreliella
WP_010257233 117 GFKAILRDIKAKDSLNEDNHSESEga------neSIPIRILVKDKELYNFCKQDTKRLYFIIEKIYKEKRDVLSELIIEY 190 Lyme disease sp...
WP_012665630 117 GFKAILRDIDGQNFINKDIYNESKdt------neSIPIRILVKDKEIYDFCKQDSKRLYFIIERIYKEKKEILSELIIEY 190 Borreliella spi...
WP_029346842 104 GMIEIYRNIKSK-EVVDKKSIQNS----------IKPLRFQLKRQDSYDFYKSNAKFTGYLLDKIFSSDKDYLNKIFKEY 172 Borreliella gar...
WP_002658520 108 GLKGVYRNILNV-EIKEDKSKQNP----------IKPLRFQLKKQESYNFYKKNAKFTSFMMDEIFENQKDLINKLLKKY 176 Borreliella
WP_012672902 108 GLKGVYRNILNL-EIKEDKSKQNS----------IKPLRFQLKSQESYAFYKSNAKFAGYLLDKLFNNEKEIIKRIMKEY 176 Borreliella fin...
WP_014017598 113 GFNQAYKKIKKS-DIDKNISKQNP----------IKPLRFQLKKQESYNFYKKNAKFTSFMMDEIFENQKDLINKLLKKY 181 Borreliella bis...
WP_012622088 113 GFAETYKRIKNSNNIDKSIAKENS----------IKMLRFKLKNRESYDFYGKNAKFTSYFLDRVFTDKKDLLEEFMKEF 182 Borreliella gar...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap