Conserved Protein Domain Family
S2_P23

?
NF033723: S2_P23 
S2/P23 family protein
Statistics
?
PSSM-Id: 411310
Aligned: 26 rows
Threshold Bit Score: 160.99
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_006433615     55 VDIAVSQPYMELVDWNGDLIKELVG-ISYSFI-------NAFSKIgSSAIISFDLSNEASKRYKIIKLEF--------LS 118 Borreliella ...
WP_014653406     98 VTWIKTKA-MAILDEHGQAIPEFKNkFGYSYIlspikmdNKYSNY-TSLLILFETTKNGDKEYEIEDIKFitagsnleLK 175 Borreliella ...
WP_011193507     73 VTWIKTKA-MTILDEYGQAMPEFKNkFGYSYIlspikmnDEYSSF-TSLLILFETTENGDKEYEIEDIKLitagsnleLK 150 Borreliella
WP_014023189    105 IRWIKIKA-RDLFGEHGDFIKELSG-IKYSYLvsp--vdGGYLSY-AMPLIIFETTRESDPLYSISGFKLisrgsdinFN 179 Borreliella ...
2_ncbifamImport   1 VRWIKIKA-RDLFGECGDFIKELKG-IKYSYLvsp--vdGSYISY-AMPIIVFETTRESDPLYSVSGFKLiskgndinFN 75 
WP_011187146     95 IRWIKIKA-RDLFNERGNSIKELKG-IKYSYLvsp--vsGSYISY-AMPLIIFETTCESDPIYSVSGFKLiskgsninFN 169 Borreliella ...
WP_014486480     80 IRWVKIKA-RDLCDERGNCIKELNG-IKYSYLvsp--idGSYISY-AMPLIIFETTSESDPFYSVSGFKLinkgsdinFN 154 Borreliella ...
WP_012539415     88 ITWIKNNFQKIIETDTQKESKLLQGkLHYTYIvapikshDEYTKY-VMPLILFASLVDY---IEIISFKLkcrp-nlnLD 162 Borrelia dut...
WP_014683196     91 VTWIKNKA-LTINGLDSKPISELQNkIRYSYSispikedGALSNK-IMPIVLFETTQNG-QDFEVTSFTLtdap-nlnFN 166 Borrelia cro...
WP_014683195     95 VTWIKNKA-ISIKGEDGQPLNELINkIRYSYSispikenEKLSNN-IMPIVLFETTQNGGQDLEVTSFTLtdep-nldFN 171 Borrelia cro...
WP_006433615    119 PDKg---NFINNLssltSGNQKSKKELSKDAYSFGTLk------TDSLSKTIAEYYKNNNWYYILAAITVENNINKETKK 189 Borreliella ...
WP_014653406    176 NP----------L----LVVENSQEEGYVTAYPFGILm------SEELKDAFKTTYQNGHWNYMLANLTVKNKLTQKTKI 235 Borreliella ...
WP_011193507    151 NP----------L----LVVENSQEEGYVTAYPFGILm------DEELRKAFQLTYQNGHWNYMLANLTVKNKITQKTEI 210 Borreliella
WP_014023189    180 ENKg---GFFGGL----PMSEKSVESGLVTAYPFGSSn------AKKVVEAFVSLYNNGTWSDMIAEISIKSKQHPKNEK 246 Borreliella ...
2_ncbifamImport  76 ENKs---GFWGRL----PMSEKSVESGLVTAYPFGSSd------AKKVIEAFASLYNNGTWSDMIAEITIKSKQYPKNEK 142
WP_011187146    170 ENKg---GFLVGL----PMSEKSVESGLVTAYPFGSNn------AKKVVEAFTSLYSNGVWSDMIAEITIKFKKPPQTEK 236 Borreliella ...
WP_014486480    155 DNKg---GFLGGI----PMSEKSVESGLVTAYPFGSSd------SKRVVEAFTALYNNGIWNDMIAEITIKSKNPPQNEK 221 Borreliella ...
WP_012539415    163 FEKgsmqNLRNRVa--dQVNKAVKAQGYKKAYLYGTInmlypegGKDLINAFKSQYKNGNWSFMEAEITIKDTLDHKTTT 240 Borrelia dut...
WP_014683196    167 KRQy---SALTSLfytpPKSEKSQENGYVNAYPFWI--------ANQNDEVIKALTQN---KLIRAKIKVKNPKTRFAEE 232 Borrelia cro...
WP_014683195    172 TRQy---SALTSLlytpPKTETSQESGYANANPFWI--------ANKNDKVIKALTKN---QSIKAKIKVYNKNSKTTTE 237 Borrelia cro...
WP_006433615    190 -YEIRINPKIYNDFQKKLRLYFKSNQVKKFPIPII 223 Borreliella spielmanii
WP_014653406    236 -YKISLNSKLIIDFLKEVLKENSILKDINGDLFED 269 Borreliella garinii
WP_011193507    211 -YKISLNSKLIIDFVKEVLKENPILKETNGDLFED 244 Borreliella
WP_014023189    247 vYRISLDSQLFNVTMKKIIEKYPKIKSASFAFNSL 281 Borreliella bissettiae
2_ncbifamImport 143 vYRITLDSQLFNVAMKKIIEKYPKIKSASFAFNSL 177
WP_011187146    237 vYRISLDSKLFNVAMKKIVEKYPQIKSASFAFNSL 271 Borreliella bavariensis
WP_014486480    222 vYRISLDSKLFNVTMKKIIEKYPNIKNTSLTFNSL 256 Borreliella afzelii
WP_012539415    241 -QSILLDSIMFNEFLKLVIKKHPDIKEANNQFRAP 274 Borrelia duttonii
WP_014683196    233 -YDIELDTQYLILLITDVLQKNPGLSTVAPNFNLK 266 Borrelia crocidurae
WP_014683195    238 -YNIILESHYLSQLIKETLQKYPQLNTVAPEFKLL 271 Borrelia crocidurae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap