Conserved Protein Domain Family
HPDL_rSAM_activ

?
NF033717: HPDL_rSAM_activ 
4-hydroxyphenylacetate decarboxylase activase
4-hydroxyphenylacetate decarboxylase activase is a radical SAM enzyme, found in anaerobic bacteria where 4-hydroxyphenylacetate decarboxylase occurs and required to prepare the glycyl radical active site of the enzyme.
Statistics
?
PSSM-Id: 468152
Aligned: 10 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_019878800  13 DLVGEIFDIQAYSVHDGPGCRTLVFLSGCPLRCEWCANPEGLEKRNRNLYRVTKCIHr-TRNCERCIAACPHQAVASNTd 91  Succinispira mo...
WP_013625682   5 QDKALISSIESFTTHDGPGCRTTIFFAGCPLKCDWCANPEAMESKRKILFAEQNCRA--RDGCSRCVKACPHGALRSAN- 81  Syntrophobotulu...
WP_016477790  15 DLKGRIFDIQSFSVHDGPGCRTLIFMSGCPLRCSWCCNPESFYNRQGKLYMGSKCINtaSKPCTRCTNACPYGAVHDNSq 94  Atopobium sp. o...
WP_009003410   2 EKKGLIFDIQGFSVHDGPGDRTLVFLSGCPLRCEWCANPEGKKLKQNLLFTSGRCKAv-QNHCKSCVAACPRGAITMDQe 80  Clostridium sp. D5
WP_017352502   3 KNKGLIFDIQSYSVHDGPGCRTTCFFSGCFLKCEWCANPESWTKKEKIMFAEGKCKH--DQGCNRCEKACEKKAISFKDd 80  Clostridium
WP_009888001   6 QLEGMIFDVQSFSVHDGPGCRTTVFLNGCPLSCKWCANPESWTVRPHMMFSELSCQY--ENGCTVCHGKCKNGALSFNLd 83  Clostridioides ...
WP_013251891   4 QLTGMVFDIQSYSVHDGPGCRTNVFLDGCPLECRWCANPESQRPRKQLMFAERTCKW--DQGCRACRDACPHGSLAVSDe 81  Olsenella uli
WP_007061355   2 KEKGLIFDIQSFSVHDGPGCRTSVFFTGCPLQCKWCANPESWIKKKHIMVAENVCKW--KNGCRACINVCSHDSIKFSEd 79  Clostridium car...
WP_009001410   2 EKKGLLFDIQSYSVHDGPGCRTNVFFIGCPLECRWCANPESWKRKKHIMFAEKVCKY--DKGCRACRDTCPKGSIKFDEn 79  Clostridium sp. D5
WP_005035452   2 AVKGHLFDIQSFSVHDGPGCRTSVFLTGCPLQCAWCANPESWVVSKHLMYAENLCKW--DKGCRACRDACPSGSIRFDGd 79  Holophaga foetida
WP_019878800  92 ldsEIPlLIDWDKCYQCTTLECTQACLEDAFKVCSKKYTVRELLAIFNRDRHFWAGKGGVTFSGGEPMYQYEFLQAVLKS 171 Succinispira mo...
WP_013625682  82 ---GAL-QIDRGICTDCISFHCTEVCHLDAIRLCGKDYTADQLMERLRIDSGSWGEGGGVTFSGGEPLRQAGFLLSLLPI 157 Syntrophobotulu...
WP_016477790  95 d-pEHPmKFDWELCHTCTTLECIDACFDDALVRISKEYTVEEIMYILERDRHYWSGNGGVTFSGGDPMFQPEFLEAVLAR 173 Atopobium sp. o...
WP_009003410  81 --sGLP-KIQRAHCVDCTDYQCMNVCNYEALRVSGTYYTLEELMDVLKRDKDFWGADGGVTFSGGDPIIQWEFLLDALKE 157 Clostridium sp. D5
WP_017352502  81 ---NLL-NVNWKVCENCTSFECAKVCYNEALRICGKYYTVDSLLKILNRDRQFWGSNGGVTFSGGEPFYQSEFLISTLKK 156 Clostridium
WP_009888001  84 ---NKP-VIDWNICKDCESFECVNSCYYNAFKLCAKPYTVDELVQVIKRDSNNWRSNGGVTFSGGEPLLQHEFLHEVLLK 159 Clostridioides ...
WP_013251891  82 ---AGP-SFNWKACLECETIECVNSCAAGALKQPVREMTVDGLLGVLDRDRSNWGSDGGVTFTGGEPLMQSDFLVEVLKG 157 Olsenella uli
WP_007061355  80 ---GKL-GISWDTCEECETFDCVNICPNNALKQCVKEYTVDELMTILKRDFNNWGSDGGVTFTGGDPLMHHEFLVEVLKK 155 Clostridium car...
WP_009001410  80 ---GKP-SLTWSICEDCESFECISLCPNNALKQCVKEYTVDGLMKILKRDFNNWGSEGGVTFSGGDPLMHHDFLYDVLME 155 Clostridium sp. D5
WP_005035452  80 ---GRH-RLTRETCLDCRTFDCVASCPNSVLKQCVKDYTVDELVSILRRDFNNWGPDGGVTFTGGDPLVQHGFLLEVLER 155 Holophaga foetida
WP_019878800 172 CREVYIHTAIETSGFASREVYLNTMNLIDFAFNDLKHIDSAKHQEKTGVSNEQILGNIEALARSNWPGRLVLRSPIIEDF 251 Succinispira mo...
WP_013625682 158 LKRENIHTAIETSAFAAEEVFQAVMDEIDFAFIDIKHVDPTLHHSRTGVDNTPILSNITALARSGYQGRLIIRVPMVAGY 237 Syntrophobotulu...
WP_016477790 174 CDELYIHKAIETEALADTPTYLRIMRYMDFAFNDLKCMDSELHRAYTGVGNERILNNIRAFANSGNHTRLILRAPVIPGL 253 Atopobium sp. o...
WP_009003410 158 CKKNNIHTAIETSAYTDENIFLKVLEYIDFAFVDIKNMDSEAHKEKTGVGNEEILRNLRALKKSGWKGRIVLRTPIIPEF 237 Clostridium sp. D5
WP_017352502 157 CKEMYINTAVETTAFVDTDIFLEGMKYVDFAFIDIKHMDREKHKEKTGAYNDLILKNIKELINCNWQGRLVIRMPVIHDF 236 Clostridium
WP_009888001 160 CHEVNIHTAIETSACVSNEVFNKIFKDIDFAFIDIKHMDREKHKEQTGVYNDLILENISNLANSDWNGRLVLRVPVISGF 239 Clostridioides ...
WP_013251891 158 CRKTWIHTAIETSGFTSTERFLEVFKRIDFAFVDMKNMDDEAHVWGTGVSNKQILRNISALAQTNWPGRLVLRVPTIAGY 237 Olsenella uli
WP_007061355 156 CYDSQIHKAIETSGYAKQEVFLEVLKYIDFAFIDVKNMDREKHKQGTGVYNDLILSNIEALKKSNWKGRLVLRQPTIAGY 235 Clostridium car...
WP_009001410 156 CKKAHIHTAIETSGFATEENFLKILTNINFAFIDVKNMDTEAHKWGTGVGNELILSNIEALVKSPWRGRLVLRQPTIHDY 235 Clostridium sp. D5
WP_005035452 156 CRVLQIHTAIETSACVSRDIFLGVMPYVDFAFIDVKHMDRDRHREGTGVANDLILSNIAALRASDWGGRLVLRQPTIGGF 235 Holophaga foetida
WP_019878800 252 NDTAENMLGIAEFMKRVGLEEFNLLPFHRLGDSKWKQCGMEYPYt-fYEATPPEKLRALQKILLDQGIKAYVGSSTPF 328 Succinispira mobilis
WP_013625682 238 NDTVENMTATARFMSGLDLKEINLLRFHRLGESKWRQLGKESPY---DDKPSAIDLSGMKEIFAQKGIACYIGEDTPF 312 Syntrophobotulus ...
WP_016477790 254 NDSKENFSKVADFMNEIGLDEFNLLPFHRLGVSKWEELSMDYAFk-nEQPTPPHTLAKLQKVLLDRNIKCYLGSDTPF 330 Atopobium sp. ora...
WP_009003410 238 NDSVENAEKTADFMNENGFFEINLLPFHRLGTSKWEQLGTTYKYk-nQDALSKEDLLYLQDVYFDKGIACYLDTDIIY 314 Clostridium sp. D5
WP_017352502 237 NDTVENAMATADFMNDLGIYEINLLPFHRMGDSKWTQLGKKYSYr-nDEPTSEEKLDELQDVYLDRKIACYVGSETNF 313 Clostridium
WP_009888001 240 NDSAENISDIISFMHKNNLIEINLLPFHRLGESKWIQLGKEYEYs-dKGDIDEEHLEELQDIFLDNGIACYVGHETAF 316 Clostridioides di...
WP_013251891 238 NDSDENARQVIDFMNENDLYEINLLKFHRMGQTKWEQLGLEYEYa-nKGDMDDERMSELQDMYLDAGIACYVGDDTPF 314 Olsenella uli
WP_007061355 236 NDNDENAYKLIEFMNKNSLYEINLLKFHRLGETKWNQLGKEYEYs-kHGDMTNEKMEHLQQLYLDNNIACYIGDNTPF 312 Clostridium carbo...
WP_009001410 236 NDSDENAMKLIEFMKRLDLFEINLLKFHRMGTSKWEQLGKQYEYt-dHGDMTDERMIELQNLYLENGIACYIGDDTPF 312 Clostridium sp. D5
WP_005035452 236 NDDEANALQVIDFMNTHGLYEINLLTFHPLGETKWNQLGKDYAYtsgRGNVAPGALERLQQLYLKHNIACYIGENTPF 313 Holophaga foetida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap