Conserved Protein Domain Family
glycyl_HPDL_Lrg

?
NF033715: glycyl_HPDL_Lrg 
4-hydroxyphenylacetate decarboxylase large subunit
4-hydroxyphenylacetate decarboxylase, an enzyme with a glycyl radical active site, depends on a radical SAM enzyme for activation, and is found in strict anaerobes such as Clostridium difficile. It has a large and a small subunit.
Statistics
?
PSSM-Id: 468151
Aligned: 8 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003149250   8 PMKLSEVLAERGLSLeshangEAPAEITDREIKrEPTPRANYLRDIYFDTLSSLDIQESYWYSRAAVEHEGEVPIMRRGY 87  Atopobium rimae
Q38HX4         5 ETKLEDVLKSRGIDM------KDAYNISEADIP-EAKESTQKLMDIYYTLKVTADMEAAYWYNRTWWENDGEVIEVRRAK 77  Clostridium sca...
WP_005952614   4 KQKLEEILRKRGIAA------LHTDDTKEEDIP-EASDRFKKLMDIYYTLKVTADMETPYWYNRIWWENDGDLIEVRRAK 76  Blautia hydroge...
WP_013251893   5 QAKINEILEDRNRFRsl--dvDAMEDYSEEPIP-DPSPRFTKLMDIYYVLKNTIDMEYPYWYNRTWWQNDGDLPEIRRAK 81  Olsenella uli
Q84F16         6 EDKIRSILEAKNIKSn----fQNKENLSEFNEK-KASKRAEDLLDVYYNTLSTADMEFPYWYNREYRKSDGDIPVVRRAK 80  Clostridioides ...
WP_017352501   4 KTKLADILAEKGLPInfqfggEAPEEMTTREINkEPAPRAKRLREIYYDTLSTANTEFPYWYNRRWNELEGEVDVVRRAE 83  Clostridium
WP_019878801   2 ARKLVDILAKEGIPLqqqvggVAPDEIVDREIHkEPTPRGKYLKDIYLQTLSSTTCEFTYWYNRKYKETEGDLPVIRRAE 81  Succinispira mo...
WP_014223608   2 AKSFKEMLVESGQELefqsggKAPDHLVDREIKwEPHPRIAKLKGIYMDSLSSTNNEFPYWYTREYFQGDNEIPVIRRAK 81  Tannerella fors...
WP_003149250  88 ALKSVFEHLDTPIWPHEQLVGAKAGFYRGSAPLPWLTESFFMDKDSDLYKAALDTGAESSAEVSHFGAGGGNVTQSFGNV 167 Atopobium rimae
Q38HX4        78 AVAASLSHMTPTILPYEKLVMNKTKNVRGAFPFPWVCASFFNAQAEALMNEVDAPAENEADSVSVVGAGGGNVTESYGNV 157 Clostridium sca...
WP_005952614  77 AVAGGYAHTTPTILPYEKLVMNKTKDIRGAFPFPWVCASFFNSLAESLMNEVDAPAENEADSVSVVGAGGGNVTESYGEI 156 Blautia hydroge...
WP_013251893  82 SEAAALSHMTPTIWPGELLVMNKTKNWRGAFCFPWVDASFFNAQAEALLAQADAPALSAADSVSQVGAGGGNVTKSFGNV 161 Olsenella uli
Q84F16        81 ALKAAFSHMTPNIIPGEKIVMQKTRHYRGSFPMPWVSESFFVAQGEQMREEAKKLASNTADELTKFGSGGGNVTESFGNV 160 Clostridioides ...
WP_017352501  84 SLKCAYSHLTPNIIPGEKLVMQKTNYYRGSFPMPWLSEGFFVAKEDELYKEALNRGSASAGELSKFGTGGGNVTKSFGSV 163 Clostridium
WP_019878801  82 ALKAGFSRQSVVIFPKELLVGGKAPYYRGSFPMPWLSEGFFLAKEDELYQAALSAGKASADEVSVFGAGGGNVTKSFGNV 161 Succinispira mo...
WP_014223608  82 ALKCAFSHLTPVIFPGELLTMRKGAFMRASFPMPWLSEGFYMANESKFYQEALKRGSASVDEHSTFGQGGGNVTKSFGKV 161 Tannerella fors...
WP_003149250 168 VSVGGKYGVRLENVPAMHRLAYSWAGKSVEDVARKYEQMVPEYKIKENIMKSVVSNFDSgFTIPQGREVMNYYFVLEHGF 247 Atopobium rimae
Q38HX4       158 ISIAKKFGMRKEEIPVLVKTSKPWEGISVEELSNKYSKMTPGYDQFKNIMESVICMFDS-FAIPQGREVINYYMPLQYGF 236 Clostridium sca...
WP_005952614 157 ISIAKKFGMRKEDIPVLVKVSKYWDGISVEDVSTKYAKMIPEYDQFSAVMDSVVVMFDS-FAIPQGREVMNYYMPLQYGF 235 Blautia hydroge...
WP_013251893 162 VSIAQKFGLRKEEIPVLVKVARYWMTNSVEVKTAEYSAMIPDYYKYKSYRDTVLVMFDS-WAIPQGREVMNYYMPLEYGF 240 Olsenella uli
Q84F16       161 VSIAGKFGMRKEEVPVLVKMAKEWVGKSVEDLGFHYEKMMPDYDLKENLMSTLICMFDSgYTLPQGREVINYFYPLNYGL 240 Clostridioides ...
WP_017352501 164 VSIAGKFGMRQEEIPALVKLAKEWVNRSVDDLGHKYEQMVPGYEIKENIMKSLICMFDSgFTLPQGREVVNYYYPLQYGF 243 Clostridium
WP_019878801 162 VSISGKYGVRKDEVPVMTRLAKEWFNKSVDDIGHKYEQMVPEYDIKEKVMRSVICMFDSgYTLPQGREVINYFFPLNYGY 241 Succinispira mo...
WP_014223608 162 ISIAGKFGMRQEEVPMLLELARMWEGKSVDDLGNKYEKMVPDYDVKEAIMRSVVCMFDSgFTLPQGREVINYYYPLEYGF 241 Tannerella fors...
WP_003149250 248 DELIDICKKRAGEVAGEPG-GDGIAGMDRLYYYTAMGLLVQGLSKWFDNYGKEADRLISITTDEAEIAELREISDRLHRL 326 Atopobium rimae
Q38HX4       237 DGIIKLCDEKIAEVMGEAG-DDGDFGMSRGYYYAAMKEITKGLSAWCENYSKRAKYLASIETDSEIKANYEKIEEVMGNI 315 Clostridium sca...
WP_005952614 236 DEIQKMCDDRIALVMGEAE-DDGILGMSRGYYYAAMKEVCKGLSKWCENYARRAKDLASRERDPEFKKNYEEIAEVMENI 314 Blautia hydroge...
WP_013251893 241 DRLLEMCDEKIADLLGEADnGDGVLGMSRGYYYIAMKEIIKGLIQWAENYAKRATFQAELETDPQQKKDYEDIAVVMHNI 320 Olsenella uli
Q84F16       241 DGIIEMAKECKKAVAGNAS-GDGLIGMDRLYFYEAVIQVIEGLQTWILNYAKHAKYLESIETDLEAKKEYSDLVEILEHI 319 Clostridioides ...
WP_017352501 244 DGLIDMAMECKKKVAGNAD-GDGLVGMDRLYFYEAVKITLQGIQNWILNYEKHARDLALIEKNEVQKEEYLEIADCLGWI 322 Clostridium
WP_019878801 242 DELIKMCEEGKNAVAGRAD-GDGVIGMDRLYFYEAARLVFEGIQQWHLNYVTEAKRLAGITKDEKQKAEYLEIAEIMEHI 320 Succinispira mo...
WP_014223608 242 EGIKEIAREKIEEVAGRAD-GDGMVGMNRLYNYQAIILVIEGIQAWIHNYGKHATWLAEREKDPAQKKEYEDIAERLFWI 320 Tannerella fors...
WP_003149250 327 AHEKPKTFKDAFQTIYLLHLAELNEDAMSGLSPGRIGQVLYPYFEQDIENGILTEEEVEEWQELYRVKMTCIDAFACTGV 406 Atopobium rimae
Q38HX4       316 AHKKPANFWEAIQMTLCCHFGVVNEDPQSGLSIGRLGQVLQPFYEKDVEDGIMTDEEVIELLELYRIKITCIECFASAGV 395 Clostridium sca...
WP_005952614 315 AHKRPASFREALQMTLCLHYGVVNEDPQSGQSIGRLGQVLQPFYEKDIEEGKITDEEVIELLELYRIKITCIECFASAGV 394 Blautia hydroge...
WP_013251893 321 AHKQPSSFREALQLTFLLHLAVVNEDPQSGQSIGRIGQVLQPFYAKDLREGKITEEDAIELLELYRIKITSIECFASSGV 400 Olsenella uli
Q84F16       320 AHKQPRTFREALQLTYTIHIASVNEDAISGMSIGRFGQILYPWYEQDIEKGLITKEEVIELLELYRIKITCIDCFASAGV 399 Clostridioides ...
WP_017352501 323 AHKQPRTFREALQLTYIIHIAVINEDAISGLSPGRVGQVLYPWFKQDMENGRITEKEVLELLELHRVKFTCIDCFASTGV 402 Clostridium
WP_019878801 321 AHKQPRNFREALQMMYLIHIGVLNEDAISGMSPGRVGQVLWPWFEQDMAAGRITEEQVIELLECYRVKMTCIDCFASMGV 400 Succinispira mo...
WP_014223608 321 EKYQPRTFIEAFQMIETLHFAVLNEDAISGLSPGRIGQVLYPWFEQDIEAGRITEDQVLELCEQDRVIKTAIDCFASVGV 400 Tannerella fors...
WP_003149250 407 VGGVLSGNTFNNVCIGGVDRDGKSAANRLEMIMLDAGINCQTTQPTLSLLYDETNPEEFVMKCMECVKTGAGYPAIMNNR 486 Atopobium rimae
Q38HX4       396 SGGVLSGNTFNNLSLGGQNYDGLSAVTPLEYLIVEAGMRNQTPQPTLSVLYDEKTPEDFLMKAASCTKLGLGYPAWMNNQ 475 Clostridium sca...
WP_005952614 395 SGGVLSGNTFNNLSLGGQSYDGRSAVTPLEYLILEAGMRAKTPQPTLSVLYDEKTPEDFLMKAAQCTKLGLGYPAWMNNQ 474 Blautia hydroge...
WP_013251893 401 TGGVLSGNTFNNLGLGGLGLDGLTAVTPLEYLIVEAGTRGKTTQPTLSVLYDEKTPEDFLMKAARCCKGGMGYPAWMNNQ 480 Olsenella uli
Q84F16       400 NGGVLSGNTFNTLSIGGLKEDGSTGANELEELLLEASMRCRTPQPSLTMLYDEKLPEDFLMKAAECTKLGSGYPAWVNNS 479 Clostridioides ...
WP_017352501 403 VGGVLSGNTFNNLTLGGLKKDGSSAANRLEYLIVEAGITCATPQPTLSCFYDEKLPEEFLLKCIECDKTGSGYPAWMNNR 482 Clostridium
WP_019878801 401 VGGVLSSNTFNNLTMGGLTKDGQSAANRLEMLIMEASISCQTTNPTLSVMYDEKTPEEFMMKAMECEKAGLGMPAFMNNR 480 Succinispira mo...
WP_014223608 401 VGGVLSGNTFNTLSIGGVNRKGKTAVNRLEYLILKAGGTNAMPQSTLALLYDETTPKDFLALAADVIKIGSGYPAFMNNQ 480 Tannerella fors...
WP_003149250 487 IAMEFLLNQYAHEGMTVQEARAWSVGGCLETSPGTWMPLHLNGKLYWIPGGSAQPTSVGIHFLNNPKILELALNNGFDKR 566 Atopobium rimae
Q38HX4       476 TGMNFMMRNYGPEGMDLHDARAWCLGGCLESAPGCFLPLEYNGKVTMIPGGASPTCGTGVHFIGMPKVLELVLTNGLDKR 555 Clostridium sca...
WP_005952614 475 TGMNFMMRQYGPEGMNLEDARAWCLGGCLESAPGCFSPLEYNGKVTMIPGGASPTCGTGIHFTALPKILELVLTNGVDRR 554 Blautia hydroge...
WP_013251893 481 TGMNYMLRNYHDEDMTVEDARAWMLGGCLESSPGTFLPLHYDGKVTMVPGGAGPTAGTGIHFTGLPKMLELVLTNGRDVR 560 Olsenella uli
Q84F16       480 NGTTFMMKQFADEGMTVEEARAFALGGCLETSPGCWKQLTLNGKTYSIAGGAGQSAGSGVHFIANPKILELVLMNGKDYR 559 Clostridioides ...
WP_017352501 483 GAIEFMMNQYSDEGMTIEEARSVAIGGCLETSPCTWKELTLNGEKFDIPGGAGQPTSVGVHFIANPKVLELVLTNGKDYR 562 Clostridium
WP_019878801 481 GGMEFLLQQYGPEGMTVEEARAIAIGGCLETSPCCWKELTLNGKKYWIPGGAGQPTSVGVHFIANPKVLEMVLTNGYDHR 560 Succinispira mo...
WP_014223608 481 IAEKFILSQYGAEGMTVEEARAWAIGGCLETSPGCWKPLHLNNKEYWIPGGCGQPTSVGVHFISQPKVLELVLFNGVDQR 560 Tannerella fors...
WP_003149250 567 TGLQVFPPHDKSFETFEELDEQYKAYYQKACEVLNKCMNIQHDVWRKFTPSMVNSLLKPNCLEKGLGIAHKGYRYNSTFN 646 Atopobium rimae
Q38HX4       556 TGKQVYPPHNKKLDSYETMVNQWKEYMELTTDVVNRCNNIQMDIWRKYNMPAVNSLLKPDCFKKGKHIGTMGARYNSCIN 635 Clostridium sca...
WP_005952614 555 TGKRVFPAHNEKIETYDQMVALWQRYLDISNRIVNRVNNMQMDIWRKYNMPAVNSLLKADCFKKGQHIGNCGARYNACIN 634 Blautia hydroge...
WP_013251893 561 TGIQVFEPHNNKLETLQDVWDVWSAYMEELLEISNRVNNIQMDIWRKINPPTVASLLKPDCFAKGQTLSNMGCRYNATIN 640 Olsenella uli
Q84F16       560 MNIQVFEPHNKPLDTYEEVIEVFKDYYKQAINVLERANNIELDIWRKFDTSIINSLLKPDCLDKGQHIGNMGYRYNATLN 639 Clostridioides ...
WP_017352501 563 TNLQVYPPHNKKLETFEEVVNQFKEYYELTCDVLAKTNNIQHDIWRKKNMSIVNSLLKPNCLDAGKHIGNLGYRFNATYN 642 Clostridium
WP_019878801 561 TGLQILPAHNKKFATFEDLNDQFKEYYAIVIDCLATTNNIQHDIWRKQNMGIFNSSLKPDCLAKGQHIGNLGYRYNGTFN 640 Succinispira mo...
WP_014223608 561 TGNRVYPAHDKKLETYEELVEQYKAYWQKTVDILCLCNNIQHDIWRKNNMSIVNSLLKPDCLDKGHLINELGYRYNATFN 640 Tannerella fors...
WP_003149250 647 IECCGTCNQINSMAAIKKLVYEDKKYTLEQLKDALDNNFGYKTSKEVGSESLKDQEKRADDdGRYDEIHADCLRAPKYGN 726 Atopobium rimae
Q38HX4       636 FESCGTITFVNSLSSIKKNVFDDSKFTIEEMTDAMLNNFGFKTAYETEVFSPDFRESTDKS-TKYEKIFAACVNAPKYGN 714 Clostridium sca...
WP_005952614 635 FESCGTITYINSLASIKKNVFDDQKYTLEEMTDAMVHNFGFKTAYETNVFSPDFRESTPEA-AKYAQIFADCVNAPKYGN 713 Blautia hydroge...
WP_013251893 641 FESCGTVTFINAMASLKKNVYDEKKYTIEEMTDALLNNFGFKTAFETGVFSPDHREATEDA-PKYEKIFFDCVNAPKFGN 719 Olsenella uli
Q84F16       640 VETCGTVTMVNSFAALKKLVYDDKAFTIEEIKDAILNNFGFKDALEVGNYSMADQVKVDKT-GKYDAIYKACLDAPKYGN 718 Clostridioides ...
WP_017352501 643 VESCGTINTINSLASLKKLVYDDKKYTLDEMREAMLNNFGFKTAEEIGSYSLADQEKADIS-SKYDDIYGDCLLAPKYGN 721 Clostridium
WP_019878801 641 VESCGTANQINALAAIKHLVYDTKKYTLEQMIDAIQNNFGFKTAAEVGSFSLAAQEKRDNDkGEYDQIHADCLRAPKHGN 720 Succinispira mo...
WP_014223608 641 VESAGNITFINSMAALKKLVYDDKKYTLDEMRDAFIHNFGFKTAQEIGKFSLMEQEKASDS-TKYDRMHFDCLNAPKYGN 719 Tannerella fors...
WP_003149250 727 DDPYVDQMLYDWEQWFCNDLPaTIENLYGEPYYVCQMSVSTHGPEGAVTAATADGRLQGTTFADASMSAYPGTDTHGQYA 806 Atopobium rimae
Q38HX4       715 ADKYADEIFKAYHYYIYDMTH-KFRSYYGKPLYLCQISVSTHGPQGFVTLATADGRLAGTTYSDGSVSAAAGTDKNGIYA 793 Clostridium sca...
WP_005952614 714 ADPYVDQLLRDYQMYLKDYLP-TLKSYYGKPEYLCQISVSTHGPQGFVTLASADGRLAGTTYSDGSVSAAAGTDKNGIYA 792 Blautia hydroge...
WP_013251893 720 ADPYVDSLMVDYEILMKKLVP-ACKSYMGKPLYMCQISVSTHGPQGAITLADAGGRLAGTTYSDGSVSAAAATDKNGIYA 798 Olsenella uli
Q84F16       719 NDLYADNILKNYEVWLSKVCE-EAQSLYAKKMYPCQISVSTHGPQGAATLATPDGRLSGTTYSDGSVSAYAGTDKNGVYA 797 Clostridioides ...
WP_017352501 722 DDSYVDSILKDYEDWFCDVCH-NYESLYGKKMYACQISVSTHGAQGAATLATTDGRLAGTTYADGSMSAYPGTDKNGPYA 800 Clostridium
WP_019878801 721 NIEMVDEILKDYEAWFCQVCR-NYESLYGKPMYACQISVSTHGAQGAVTLAGADGRLYGTTFADGSMSAYPGTDLHGAYA 799 Succinispira mo...
WP_014223608 720 DIPYVDNILLGWEDWFCNDCR-KHESLYGHPLYACQISVSTHGAMGSATMASADGRLQGTTFADASMSAYPGTDKNGPFA 798 Tannerella fors...
WP_003149250 807 LFESATGWDHSMSQNSQMNLKLHPSAAKGIEGSRKLMDLTRAYMRKGGFHIQYNIIDSRILKKAQANPENYRTLLIRVAG 886 Atopobium rimae
Q38HX4       794 IFESATVYDHSMHQNAQMNLKLHPTAVKGINGTRKLLDLVRAYMRKGGFHVQFNVVDSKTLRDAQLTPEKYRELMVRVAG 873 Clostridium sca...
WP_005952614 793 IFESATVYDHSQNQNAQMNLKLHPSAVKGLSGTRKLLDVVRAYMRKGGFHVQFNVVGSDTLRAAQKKPEAYRDLMVRVAG 872 Blautia hydroge...
WP_013251893 799 VFESATCYDHSMCQNAQMNVKIHPTAVKGAQGTRKLLDVIRAYMRKGGFHVQFNITSSKVLRAAQQKPEEYRDLMVRVAG 878 Olsenella uli
Q84F16       798 LFESATIWDQAVVQNSQMNLKLHPTTIKGQQGTKKLLDLTRSYLRKGGFHIQYNVVDSETLKDAQKNPDNYRQLMVRVAG 877 Clostridioides ...
WP_017352501 801 LFTSATVWDHSRSQNSQMNLKIHPSAIKGIEGSKKLLDLTRSYMRKGGYHIQYNVVDSKVLKEAQVKPENYRDLMVRVAG 880 Clostridium
WP_019878801 800 LFESACCWDHSQSQNSQMNLKLHPNAVAGIEGSRKLLDLTRSYMRRGGYHIQYNIVDSKVLKEAQADPGSYRDLLVRVAG 879 Succinispira mo...
WP_014223608 799 LMNSATIWDHSMSQNSQLNIKIHPSAIQGQEGAKKLIDMSSSYMREGGFHVQYNIVDSKVLKDAQAHPENYRDLMVRVAG 878 Tannerella fors...
WP_003149250 887 FTQYWVEIGKPIQDEVIARTEYES 910 Atopobium rimae
Q38HX4       874 FTQYWCEIGKPIQDEVIYRTEYDK 897 Clostridium scatologenes
WP_005952614 873 FTQYWCEIGKPIQDEVIYRTEYDE 896 Blautia hydrogenotrophica
WP_013251893 879 FTQYWCEIGKPIQDEVIYRTEYDQ 902 Olsenella uli
Q84F16       878 FTQYWCELGKPIQDEVIARTEYEG 901 Clostridioides difficile
WP_017352501 881 FTQYWCEIGKPIQDEVISRTEYEG 904 Clostridium
WP_019878801 880 FTQYWVEIGKPIQDEIISRTEYEG 903 Succinispira mobilis
WP_014223608 879 FTQYWVEIGKQVQDELIARTEYES 902 Tannerella forsythia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap